KEGG   Xanthomonas campestris pv. campestris 8004: XC_0249Help
Entry
XC_0249           CDS       T00247                                 

Definition
(GenBank) conserved hypothetical protein
Organism
xcb  Xanthomonas campestris pv. campestris 8004
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GGDEF cNMP_binding UPF0240
Motif
Other DBs
NCBI-ProteinID: AAY47336
UniProt: A0A0H2X359
Structure
PDB: 

Position
300327..301370
Genome map
AA seq 347 aa AA seqDB search
MTCHTSNGAVEPTGSVAKTLSDGLHALMTAEELAFFARFGRMREIAAGQALFERGAVGTQ
MFIVVTGQIDLDFGEDLMLKHLGPGEFFGELGLLIGDHARSAGASASVDSRLIELAHDDF
QRLVDHDPSMVAHFLRRSIVRVVNNEQLLIRQLRRRNHDLEAALDNLYVTSHQLNHTEEL
SRTDELTGLHNRRGLALHLQECRRGGGAPGVGLILIDCDRFKHINDEYGHLAGDRVLQNV
AHALRSVIAEGDLVCRLGGDEFCVLVAQGSIELVQHMGECIVNAVQARQASSPDGCHSCS
VSVGVCSIDASTSYNDWYTRADTALYQAKRQGGNSLCVYEALPLDNS
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgacctgccatacctccaacggcgccgtcgaaccgactggaagcgttgccaaaacactc
tccgatgggctgcatgccttgatgaccgccgaagaactcgcgtttttcgcgcgtttcggc
cgtatgcgcgagatcgccgcaggccaggccttgttcgaacgcggcgcggtgggcacgcag
atgttcatcgtggtcaccggccagatcgacctggatttcggcgaagacctgatgctcaag
catctgggcccgggcgagttctttggcgagctcggcctgctgatcggcgaccacgcccgc
agtgccggcgccagcgcttcggtcgacagccgcctgatcgaactggcacacgacgatttc
cagcgcctggtcgatcacgacccgtcgatggtggcgcatttcctgcgccgctccatcgtg
cgcgtggtcaataacgagcaattgctgatccgccagctgcgccgccgcaaccacgacctg
gaagcggcgctggacaatctctacgtcacctcgcatcagctcaaccacaccgaagaactc
agccgcaccgacgagctcaccggcctgcacaaccgccgcggccttgcgctgcatttgcag
gaatgtcgccgcggtggcggcgcgccgggcgtgggcctgatcctgatcgactgcgaccgc
ttcaagcacatcaacgacgagtacggccacctggccggcgaccgcgtgctgcagaacgtt
gcccacgcgctgcgctcggtgatcgccgaaggcgacctggtctgccgcctcggcggcgac
gaattctgcgtgctggtggcgcaaggttcgatcgagctggtgcagcacatgggcgaatgc
atcgtcaacgcagtgcaggcgcgccaggccagcagcccggatggctgccacagttgctcg
gtgagcgtgggcgtctgcagcatcgacgccagcacctcctataacgactggtatacgcgc
gcggacactgcgctgtaccaggccaagcgccagggcggcaacagcctgtgcgtctatgaa
gcattgccgttggacaacagctaa

DBGET integrated database retrieval system