KEGG   Xanthomonas campestris pv. campestris 8004: XC_0255Help
Entry
XC_0255           CDS       T00247                                 

Definition
(GenBank) acyl-CoA carboxyltransferase beta chain
  KO
K01969  3-methylcrotonyl-CoA carboxylase beta subunit [EC:6.4.1.4]
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Pathway
xcb00280  Valine, leucine and isoleucine degradation
xcb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xcb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    XC_0255
Enzymes [BR:xcb01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.4  methylcrotonoyl-CoA carboxylase
     XC_0255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Carboxyl_trans
Motif
Other DBs
NCBI-ProteinID: AAY47342
UniProt: A0A0H2X494
Position
complement(310342..311952)
Genome map
AA seq 536 aa AA seqDB search
MSVINSQLQVGGESFQHNAAAMRAVVEDLRATLARTALGGSEAARAKHTARGKLLVRARI
DALLDPGGALLEIAPLAAHGMYDDQVPCAGVVAGIGRVSGVECVIVANDATVKGGTYYPM
TVKKHLRAQEIAQQNRLPCIYLVDSGGAFLPLQDEVFPDRDHFGRIFYNQANLSAQGIPQ
IACVMGSCTAGGAYVPAMSDETVIVREQGTIFLGGPPLVKAATGEEVSAEELGGADVHTR
ISGVADHFADNDLQALARVRAIIAQLNWRKPALSMAVQAPLPPRHAADELYGVIPADTRR
PYDVREVIARIVDDSRLDEFKPRYGSTLVTGFAHLHGYPVGIIANNGILFSESALKGAHF
IELCTQRGIPLVFLQNITGFMVGRKYEHGGIAKDGAKLVMAVACAKVPKFTVVIGGSFGA
GNYGMCGRAYSPNFLWMWPNARIGVMGGEQAASVLATVRRDGIEAKGGAWSGDDEEAFKS
PIRAQFEQQGHPYYASARLWDDGIIDPADTRRVLGLGLSAALNAPIDATRFGVFRM
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtgatcaacagccagctgcaggtgggcggcgagagcttccagcacaacgcggca
gcgatgcgcgcggtggtcgaggacttgcgtgccacgctggcgcgcaccgcgctgggtggc
agcgaggcggcccgtgccaagcacaccgcgcgcggtaaattgctggtgcgtgcgcgcatc
gatgcactgctggacccgggcggtgcgctgctggaaattgcgccgctggctgcgcatggc
atgtacgacgatcaggtgccctgcgccggcgtggtggccgggatcggccgcgtgtccggg
gtggaatgcgtgatcgtggccaacgatgccaccgtcaagggcggcacctattacccgatg
acggtgaagaagcatctgcgcgcgcaagaaatcgcgcagcagaaccggctgccgtgcatc
tatctggtcgactccggcggtgcgttcctgccgctgcaggacgaggtcttcccggaccgc
gatcacttcggccgcatcttctacaaccaggccaatctatctgcgcaaggcatcccgcag
atcgcctgcgtgatgggctcgtgcaccgcgggcggcgcgtacgtgccggcgatgagcgat
gaaacggtgatcgtgcgcgagcagggcaccatcttcctcggcggcccgcccctggtcaaa
gccgccaccggtgaagaagtcagcgctgaagaattgggcggtgcggatgtgcacacgcgc
atttccggggtggccgatcatttcgccgacaacgatctacaggcgctggcacgggtgcgc
gcgatcattgcgcaactcaactggcgcaagcctgcgctctccatggcggtgcaggcaccg
ctgccgccgcggcatgccgccgacgaattgtatggcgtgattccggctgatacgcgcagg
ccctacgacgtgcgcgaagtgatcgcgcgtatcgtggacgactcgcgcctggacgaattc
aagccgcgctacggcagcaccctggtgaccgggtttgcgcacctgcatggatacccggtt
ggcatcatcgccaacaacggcatcctgttttccgagtccgcgctcaagggtgcgcatttc
atcgaactatgcacgcagcgcggcattccgctggtgttcctgcagaacatcaccggcttc
atggtgggccgtaaatacgagcacggcggcatcgccaaggacggcgccaagctggtgatg
gccgtggcctgcgccaaggtgcccaagttcaccgtggtgattggcggctcgttcggcgcc
ggcaattacggcatgtgcggccgcgcgtattcgcccaactttttatggatgtggccgaat
gcgcggatcggcgtgatgggcggcgaacaggctgccagcgtgttggcaaccgtgcggcgc
gatggcatcgaagccaagggcggcgcgtggtcgggcgacgacgaagaagccttcaaatcg
ccaatccgtgcgcagttcgaacagcaaggccacccgtattacgccagcgcgcgcctgtgg
gacgacggcatcatcgacccggccgatacccgccgcgtgctgggcctggggttgtcggcc
gccttgaatgcgccgatcgacgccacgcgcttcggcgtgttccggatgtga

DBGET integrated database retrieval system