KEGG   Xanthomonas campestris pv. campestris 8004: XC_0256Help
Entry
XC_0256           CDS       T00247                                 

Definition
(GenBank) acyl-CoA dehydrogenase
  KO
K00253  isovaleryl-CoA dehydrogenase [EC:1.3.8.4]
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Pathway
xcb00280  Valine, leucine and isoleucine degradation
xcb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xcb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    XC_0256
Enzymes [BR:xcb01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.8  With a flavin as acceptor
    1.3.8.4  isovaleryl-CoA dehydrogenase
     XC_0256
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acyl-CoA_dh_1 Acyl-CoA_dh_N Acyl-CoA_dh_M Acyl-CoA_dh_2
Motif
Other DBs
NCBI-ProteinID: AAY47343
UniProt: A0A0H2X2N2
Position
complement(311963..313126)
Genome map
AA seq 387 aa AA seqDB search
MHVPSLNFELGEDIDLLRESVAAFASHHIAPLAAAADHDNVFPAQLWRLFGEQGLLGLTV
EEAYGGSGMGYLAHVVAMEEISRAGGAIGLSYGAHSNLCLNQLRKNATHEQKQRYLPKLC
TGEHVGALAMSEAGSGSDVVSMKLRAEARGDRFVLNGSKMWITNGPDADVLVVYAKTDPS
AGARGITAFIVEKGMPGFSTAQKLDKLGMRGSNTCELVFTDCEVPAENVLGTLNGGVRVL
MSGLDFERVVLAGGPLGLMAAAMDVVLPYVHERKQFGEPIGTFQLMQAKLADMYVGLNAC
RAYVYAVARACDAGRTTRQDAAGAILYAAEKATWLTGQAIQVLGGNGYINEYPTGRLWRD
AKLYEIGAGTSEIRRMLIGRELFERTA
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgcatgtgccgtccttgaatttcgagcttggcgaagacatcgatctgctgcgcgaaagc
gtggccgccttcgccagccaccatatcgccccgcttgccgcggcggccgatcacgacaac
gtcttccccgcgcagttgtggcggctgttcggtgagcagggcctgctgggcctgaccgtg
gaagaagcatacggcggcagcggcatgggctacctggcgcacgtggtggcgatggaagaa
atttcgcgtgccggcggtgcgatcgggctgtcctacggcgcgcactccaacctgtgcctc
aaccagctgcgcaagaacgccacccacgaacagaagcagcgctacctgcccaagctgtgc
accggtgagcacgtcggcgcactggcgatgagcgaggccggttcgggctcggacgtggtg
tcgatgaagctgcgcgccgaggcacgcggcgaccgctttgtactcaacggcagcaagatg
tggatcaccaatggccccgatgccgacgtgctggtggtgtacgccaagaccgaccccagc
gccggtgcgcgcggcatcactgccttcatcgtcgaaaagggcatgcccgggttttccacc
gcgcagaagctcgacaagctcggcatgcgcggctccaacacctgcgaactggtgttcacc
gattgcgaagtgccggccgaaaacgtgctgggcacgctcaacggcggcgtgcgcgtgttg
atgtccgggctggatttcgaacgcgtggtgctggcgggtggaccactcggcttgatggcc
gcggccatggacgtggtgctgccgtacgtgcacgagcgcaagcagtttggcgagccgatc
ggcaccttccagctgatgcaggccaagctggccgacatgtacgtggggctcaacgcgtgc
cgtgcgtacgtctatgccgtggcacgcgcctgcgatgccggccgcaccacgcgccaggat
gcggctggcgcgattctgtatgccgccgagaaggccacctggctcaccggccaagcgatc
caggtgctgggcggcaacggctacatcaacgagtaccccaccgggcggttgtggcgcgat
gccaagctgtacgagattggcgccggcacgtctgaaatccggcgcatgctgatcggccgc
gagttgttcgaacgcactgcctga

DBGET integrated database retrieval system