KEGG   Xanthomonas campestris pv. campestris 8004: XC_0258Help
Entry
XC_0258           CDS       T00247                                 

Definition
(GenBank) conserved hypothetical protein
Organism
xcb  Xanthomonas campestris pv. campestris 8004
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_3 HTH_Crp_2
Motif
Other DBs
NCBI-ProteinID: AAY47345
UniProt: A0A0H2X4D0
Position
313931..314332
Genome map
AA seq 133 aa AA seqDB search
MHSPCRSRAMVAVLNPLALTERLRVPDRTILSPSAMAGLLDLSQQELAELAGVHRNSLRV
HPESPRVQDLLRNLSRLLVAMAQIQPDERQLVFHLKNTPIPAFEFATLLEVVKQGRTDDA
LTYLRTVAAGAAG
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
gtgcactcaccttgccggagccgcgcgatggttgctgtcctcaaccccctggccctgacc
gaacgcctacgcgtgccggaccggaccatcctctcgccatcggcgatggccggcctgctg
gatctctcccaacaggaactggccgaactcgctggcgtgcaccgcaacagcctgcgggtg
cacccggaaagcccgcgcgtgcaggacttgctacgcaatctttcgcgcctgctggtggca
atggcgcagatccagccggatgagcgccaactggtgtttcatttgaaaaacaccccgatc
ccggcgttcgaattcgccaccttgctggaggtggtcaagcagggccgcaccgacgatgcg
ctgacctatctgcgcaccgtggccgccggagcggctggttga

DBGET integrated database retrieval system