KEGG   Xanthomonas campestris pv. campestris 8004: XC_0262Help
Entry
XC_0262           CDS       T00247                                 

Definition
(GenBank) conserved hypothetical protein
Organism
xcb  Xanthomonas campestris pv. campestris 8004
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3649
Motif
Other DBs
NCBI-ProteinID: AAY47349
UniProt: A0A0H2X2W8
Position
complement(317108..317419)
Genome map
AA seq 103 aa AA seqDB search
MSMASPLPAPWFKRPWLGVLGRSVAAIGGGYALASATNLLLAVVLPMPRSEAVLTSMLVG
IVVCACAPLWAFATASVLRAWVGIGVPAVAMFAAAAWLQRGAA
NT seq 312 nt NT seq  +upstreamnt  +downstreamnt
atgtccatggcttcgcccctgcccgctccctggttcaagcgcccctggctgggtgtgctt
gggcgcagcgtggccgcgatcggcggtggctatgcgctggccagcgcgaccaacctgctg
ctcgcagtggtgctgccgatgccgcgcagcgaggcggtgctgaccagcatgctggtgggc
atcgtggtgtgtgcctgcgcgccgctgtgggcgtttgccactgccagcgtgctgcgcgcc
tgggtcggcatcggcgtgccggccgtggccatgttcgcagccgctgcgtggctgcaacgg
ggcgcggcatga

DBGET integrated database retrieval system