KEGG   Xanthomonas campestris pv. campestris 8004: XC_0264Help
Entry
XC_0264           CDS       T00247                                 

Definition
(GenBank) cytochrome C5
Organism
xcb  Xanthomonas campestris pv. campestris 8004
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrome_CBB3 Cytochrom_C Cytochrom_C550 Cytochrome_C554
Motif
Other DBs
NCBI-ProteinID: AAY47351
UniProt: A0A0H2X373
Position
318359..318877
Genome map
AA seq 172 aa AA seqDB search
MRNYDLEFLKKFSMVIGLLVVITLGLIALAAYLQRAVPDEVSPTAAKRLQQRIAPAGAVY
AGTTGAAAQAAAQAAALAKASSQSAYGGSTDGKTIFDNLCTACHTTGVGKAPTLDHSHWD
ARIAQGKDTLYKHAIEGYTGPDGGIMPAKGGNPALTEEQVRATVDWMLSNLK
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
gtgcggaattacgacctcgagttcctgaaaaaattctcgatggtgattggcttgctggta
gtgatcactctgggcttgatcgccctggcggcctatctgcaacgtgcggtccccgatgaa
gtgtcgcccacagccgccaagcgcctgcagcaacgcattgcgccggccggcgcggtctat
gcaggcaccaccggcgccgcggcgcaggccgccgcccaggctgcggcactggccaaggcc
tcgtcgcaatccgcctacggtggcagcaccgacggcaagaccatcttcgacaacctgtgc
accgcctgccacaccaccggcgtgggcaaggcgccgacgctggaccactcgcattgggac
gcgcgcattgcgcagggcaaggacacgctctacaagcacgcgatcgagggctataccggc
ccggatggcggcatcatgccggccaagggcggcaaccccgcgcttaccgaagaacaagtg
cgcgccaccgtggactggatgctgtccaacctgaaatag

DBGET integrated database retrieval system