KEGG   Xanthomonas campestris pv. campestris 8004: XC_0265Help
Entry
XC_0265           CDS       T00247                                 

Definition
(GenBank) nuclease
  KO
K07004  uncharacterized protein
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Brite
KEGG Orthology (KO) [BR:xcb00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    XC_0265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Exo_endo_phos
Motif
Other DBs
NCBI-ProteinID: AAY47352
UniProt: A0A0H2X4A6
Position
318979..320799
Genome map
AA seq 606 aa AA seqDB search
MAGALRHPATAVSCLRRRPGGVCVCLPLNVWSVSMLHCPFVVLGLIGLLAPVLCRAAEGA
PQRLTIADVQGEDTRSPFDGRLVEVEGIVTADTRLGLAGLFVQQPGTEPRRSHGVFVTGA
GEAQVAVGDRVRIVGTVREVGAGGDASLTTLQATTLEVLASNQPVPVRMLSGPPANWEAL
EGEHVRLAAVTLNGSDRLASNGELIAAFGGRLWQPSEVAAAGTPAFAQTEADNARRRVLL
DDARNGRTPKAVSYLPAEANLRVGSLLRQVDGIVDQRYDGQYRIQVLAPLTLPALPAPVA
PQVGGDLRIASFNLENFFNGNGRGGGFPTKRGARTHEQFQAQLAKLVATIVPLQADVAAL
MELENDGNDGDTAVAQLVAALNAAGKDKDWRFVDSGSGPGDDAIRVGIVYRSTQVTPVGK
PATLTGGPFDSHSRVPLAQAFRSSRGATFVVVANHFKSKGCGNASGADADQHDGQACWNA
TRTESAKRLHQWLQSDPTGAQTKLAVLLGDFNAYAMETPMRSLRASGWQDAFAVVGVKQP
YSYVYDGMSGRLDHALLSPAMAKQLRGAAEWHINADAMDDAGYAKRNLPGPWRSSDHDPV
LLGFAL
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
atggccggcgcactgcgtcatcctgcgactgccgtgtcctgcctgcgccgccgtcctggc
ggcgtttgtgtttgtcttcccttgaacgtgtggagtgtctcgatgctgcattgtccgttt
gtcgtgctgggcctgatcggcctgttggcgcccgtgttgtgccgcgccgccgaaggcgcg
ccgcagcgcctgaccattgccgacgtgcagggcgaggacacccgcagcccgttcgacggc
cgcctggtcgaggtggaaggcatcgtcaccgccgatacgcgcttgggtctggcgggcctg
ttcgtgcaacagcccggcaccgagccgcggcgctcgcacggggtgttcgtgaccggcgcc
ggcgaggcgcaggtggcggtgggcgaccgcgtgcggatcgtgggcacggtgcgcgaggtc
ggtgctggcggcgacgccagcctgaccacgctgcaggccaccacgctcgaggtgctggcc
agcaaccagccggtgccggtgcgcatgctcagcgggccgccggccaactgggaagcactg
gaaggcgaacacgttcgcctggccgcggtcacgctcaatggcagcgaccgcctggccagc
aacggcgagctgatcgccgcctttggtggccggttgtggcagcccagcgaagtggccgcg
gccggcacgcccgccttcgcgcagaccgaagccgacaacgcgcgccgccgggtgttgctg
gacgacgcgcgcaacggccgcacgccaaaggccgtgtcctacctgccggccgaggcgaac
ttacgtgtgggcagcctgctcaggcaggtcgatggcattgtcgatcagcgctacgacggc
cagtaccgcatccaggtgctggcgccgctgacgctgcccgcactgcctgcgccggtggca
ccgcaggtgggcggcgatctgcgcatcgcctcgttcaacctggagaacttcttcaacggc
aacgggcgcggcggcggcttcccgaccaagcgcggggcgcgcacgcacgaacagttccag
gcgcagctggccaagctggtggccaccatcgtgccgctgcaggccgatgtggccgcgctg
atggaactggaaaacgacggcaacgacggcgacaccgccgtggcgcagctggtggctgcg
ctcaacgccgccggtaaggacaaggattggcgtttcgtggacagcggcagcggcccgggc
gacgacgcgatccgcgtcggcatcgtgtaccgcagcacccaggtcaccccggtcggcaaa
ccggccacgctgaccggcgggccgttcgacagccatagccgggtgccattggcgcaagcg
ttccgcagcagccgcggcgcgaccttcgtggtggtggccaaccacttcaagtccaagggc
tgcggcaacgccagtggcgccgatgccgatcagcacgatggccaggcctgctggaatgcc
acccgcaccgagtcggccaagcgcctgcaccagtggctgcagagcgaccccaccggcgcg
cagaccaagctggccgtgttgctgggcgacttcaacgcctatgcgatggaaacgccgatg
cgcagcctgcgcgccagcggctggcaggacgcctttgccgtggtcggcgtgaagcagcct
tacagctacgtctacgacggcatgagcggccgcttggaccacgccctgctgagtccggcg
atggccaagcagctgcgtggcgcagcggaatggcacatcaacgccgacgcgatggacgat
gccggctatgccaagcgcaacctgccaggcccgtggcgcagctccgaccacgacccggtg
ctcttgggattcgcgctctga

DBGET integrated database retrieval system