KEGG   Xanthomonas campestris pv. campestris 8004: XC_0266Help
Entry
XC_0266           CDS       T00247                                 

Definition
(GenBank) conserved hypothetical protein
Organism
xcb  Xanthomonas campestris pv. campestris 8004
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MerC DUF2231
Motif
Other DBs
NCBI-ProteinID: AAY47353
UniProt: A0A0H2X2N8
Position
complement(321009..321392)
Genome map
AA seq 127 aa AA seqDB search
MRASASALDSSAIALSSLCLLHCLALPLLAAALPLLGRWEQAEWVHVVFATAAVPLSGYA
LWSSHRRHRLPAPLWGLAVFGLAGLVLGASGLLGAALETPVTVASSLLLAGAHLVNLRLR
RHVHCAR
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcctctgcgtctgcgctggacagctcggccattgccctgtccagcctgtgcctg
ctgcactgcctggccttgccgctgctggcggcggcgctgccgctgttggggcgctgggag
caagccgaatgggtgcatgtagtcttcgccaccgccgcggtgccgctcagtggctacgca
ctctggagcagccatcgccgccaccggttgccagcaccgctctgggggctggcggtgttc
gggctggccgggctggtgctgggcgccagcgggctactgggtgccgcgctggagacgccg
gtcacggtcgccagcagcctgctgctggccggcgcccatctggtcaacctgcgcttgcgc
cgccatgtgcattgcgctcgctaa

DBGET integrated database retrieval system