KEGG   Xanthomonas campestris pv. campestris 8004: XC_0267Help
Entry
XC_0267           CDS       T00247                                 

Definition
(GenBank) nitrile hydratase activator
Organism
xcb  Xanthomonas campestris pv. campestris 8004
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: cobW CobW_C RsgA_GTPase ArgK MobB AAA_16 T2SSE TsaE Viral_helicase1 AAA_22 ATPase_2
Motif
Other DBs
NCBI-ProteinID: AAY47354
UniProt: A0A0H2X2X1
Position
321454..322779
Genome map
AA seq 441 aa AA seqDB search
MPVLAPRDSRLPVTVLSGFLGAGKTTLLNRILHNREGLRVAVIVNDMSEINIDAQLLREG
GAALRRTDETLVEFSNGCICCTLRDDLLQEVKRLASERRYDYLLIESTGIAEPMPVAATF
AVRDADGFSLSDIARLDTMVTVVDGSRFLEDFGSAATLAELGQQAGPDDTRGLVQLLGDQ
VEFADVLVISKCDQIDTPRLHRLHAVLRALNRDAAIVDAAHGEVPLRQLLDTGRFDFTRA
QLAPGWMQELRGQHTPETEEYGITSFVYRARRPFHPQRFARMVQGGLPQVIRSKGFFWLA
SRMDWVGELSSVGGATQTNAAGFWFAARHRVDAHAIGEPLQTSITPLPYTDIGWQRQQTQ
CWTAPLPQLHEVGDASEYAAMQRLWHPLWGDRRQELAVIGVDMDAPRTRAALDACLLSDH
ELRQGPAQWQLLDDPFPHWQR
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgcctgtcctcgctccccgcgattcgcgcctgcccgtcaccgtgttgtccggcttcctg
ggcgccggcaagaccaccttgctcaaccgcatcctgcacaaccgcgaggggctgcgggtg
gcggtgatcgtcaacgacatgagcgagatcaacatcgatgcgcagctgctacgcgagggt
ggggcggcgctgcggcgcaccgacgagacgctggtggaattcagcaatggctgcatctgc
tgcacgctgcgcgacgacctgctgcaggaagtgaagcgcctggccagcgagcgccgctac
gactatctgttgatcgaatccaccggcatcgccgagccgatgccggtggcggccaccttt
gcggtgcgcgatgccgatggtttcagcctgtcggatatcgcccggctcgacaccatggtg
acggtggtggacggcagccgttttctcgaggatttcggctctgcggccacgctggccgag
ctcggccagcaagccggcccggacgatacgcgcgggctggtgcaattgcttggcgaccag
gtggagttcgccgacgtgctggtgatcagcaagtgcgaccagatcgacacgccgcgtctg
caccgcctgcatgccgtgttgcgtgcgctcaatcgcgatgcggcgatcgtcgatgccgcg
catggcgaggtgccgctgcggcagctgctggacaccgggcgcttcgacttcacccgcgcg
cagctggcgccgggctggatgcaggagttgcgcggccagcacacgccggagaccgaggaa
tatggcatcaccagtttcgtctatcgtgcgcgccggccgtttcatccgcagcgttttgcg
cgcatggtgcaaggtgggctgccgcaggtgattcgcagcaagggatttttctggttggcc
agccgcatggattgggttggcgaattgtccagcgtgggtggcgcgacccagaccaatgca
gcgggcttctggtttgccgcacgccatcgcgtggatgcgcatgccatcggcgagccgctg
cagaccagcatcacgccattgccgtataccgatatcggctggcagcgtcagcagacgcaa
tgctggaccgcgccgctgccgcaactgcacgaggttggcgatgccagcgagtacgccgcg
atgcagcggctgtggcacccgctatggggcgaccgtcgccaggagctggcggtgatcggc
gtggacatggatgcgccgcgcacgcgcgctgcgctggatgcctgcctgctcagcgatcac
gaactgcgccagggcccggcgcaatggcaactgctggacgatccgtttccgcactggcag
cgttga

DBGET integrated database retrieval system