KEGG   Xanthomonas campestris pv. campestris 8004: XC_0274Help
Entry
XC_0274           CDS       T00247                                 

Definition
(GenBank) organic hydroperoxide resistance protein
Organism
xcb  Xanthomonas campestris pv. campestris 8004
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OsmC
Motif
Other DBs
NCBI-ProteinID: AAY47361
UniProt: A0A0H2X381
Position
328577..329005
Genome map
AA seq 142 aa AA seqDB search
MASPEKVLYTAHATATGGREGRAVSSDSALDVKLSTPRELGGAGGDGTNPEQLFAAGYSA
CFIGAMKAVAAQDKLKLPGEISIDGSVGIGQIPGGFGIAVELKIAVPGMEPAELQALVDK
AHQVCPYSNATRGNIDVTLTLA
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atggcctcacccgaaaaagtcctctacaccgcccacgccactgccaccggtggccgcgaa
ggccgcgccgtgtcgtccgacagcgccctggacgtcaagctctccaccccgcgtgagctc
ggcggcgccggcggcgatggcaccaacccggagcagctgttcgcagccggttattcggcc
tgcttcatcggcgcgatgaaggccgtggccgcgcaggacaagctcaaattgccgggcgag
atcagcatcgacggcagcgtcggtatcggccagattccgggcggtttcggtattgcagtg
gaactgaagatcgccgtgccgggcatggagccggccgagctgcaggcgctggtcgacaag
gcccaccaggtgtgcccgtactccaatgccacccgcggcaacatcgacgtcaccctgacg
ctggcctga

DBGET integrated database retrieval system