KEGG   Xanthomonas campestris pv. campestris 8004: XC_0277Help
Entry
XC_0277           CDS       T00247                                 

Definition
(GenBank) conserved hypothetical protein
Organism
xcb  Xanthomonas campestris pv. campestris 8004
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CaM_bdg_C0
Motif
Other DBs
NCBI-ProteinID: AAY47363
UniProt: A0A0H2X2P5
Position
330561..331061
Genome map
AA seq 166 aa AA seqDB search
MTSCKRLDHWILTAYGVNYVAQQHRSPAMLDSRIEKVDLALTEIAQDPSEKVALWQWACR
EMLHETLIGMHQLSHLAGIARHVANDWRAPVDVIAPAKPYLAPSALADRRLPQVLDGLGS
TQDDADRASLWRLRYASLIASTLQGMQALAEKHRIDRQAMAISQLN
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgacatcgtgcaaacgactggatcactggattctcacggcgtatggtgtgaattatgtt
gcacagcagcatcggagccccgcaatgctcgactcacgcatcgaaaaggttgacctggca
ctgaccgagatcgcccaggacccatcggagaaggtggcactgtggcaatgggcctgccgc
gaaatgctgcatgagacgctgatcggcatgcaccagctctcgcatctggccggcattgca
cggcacgtggccaacgactggcgcgccccggtggatgtgatcgcacccgcaaagccctac
ctggcgccgtcggcactggccgaccggcgcctgccgcaggtgctcgatggcttgggcagc
acccaggacgacgctgaccgcgccagcctgtggcggctacgctacgccagcctgatcgcc
tccacgctgcaaggcatgcaggcgctggccgaaaagcaccgcatcgatcgccaagcgatg
gcgatcagccagttgaattga

DBGET integrated database retrieval system