KEGG   Xanthomonas campestris pv. campestris 8004: XC_0279Help
Entry
XC_0279           CDS       T00247                                 

Definition
(GenBank) oxidoreductase
  KO
K06222  2,5-diketo-D-gluconate reductase B [EC:1.1.1.346]
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Brite
KEGG Orthology (KO) [BR:xcb00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    XC_0279
Enzymes [BR:xcb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.346  2,5-didehydrogluconate reductase (2-dehydro-L-gulonate-forming)
     XC_0279
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldo_ket_red
Motif
Other DBs
NCBI-ProteinID: AAY47365
UniProt: A0A0H2X4E8
Position
complement(331709..332512)
Genome map
AA seq 267 aa AA seqDB search
MTVPAFGLGTFRLKDQVVIDSVRNALALGYRAIDTAQIYDNEAQVGQAIADAGVPRDQLF
VTTKIWVDRFSRDTLQPSLQESLRKLGTDYVDLTLIHWPSPKDQVPMREYLEALADAKAQ
GLTRAIGVSNFTIALTRQAIEILGADAIATNQIEVHPYLQNRTLIAFLREQGIHVTSYMT
LAVGEVLKDPVIQAIARRHDATPAQVTLAWALQQGYSVIPSSTKRANLESNLKAQSLHLS
EQDMAEIAALDRGERLANPKAIAPDWD
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgactgtccccgcatttggcctcggtacgtttcgcctcaaggaccaggttgtcatcgac
tcggtgcgcaacgcactggcgctggggtatcgcgccatcgataccgcacagatctacgac
aacgaagcgcaggttggccaggccattgccgatgccggcgtgccgcgcgatcagctgttt
gtgaccaccaagatctgggtggaccggttcagccgcgacacgctgcaacccagcctgcag
gaaagcctgcgcaagctcggcaccgattatgtcgacctcaccctgatccactggccctcg
cccaaggaccaggtgccgatgcgcgagtatctggaggcgctggccgatgccaaggcgcag
gggctgacccgcgcgatcggtgtctccaacttcaccattgcgctcacgcgccaggcaatc
gagatcctcggcgccgatgcgatcgccaccaaccagatcgaagtgcatccgtacctgcag
aaccgcacgctgatcgcgttcctgcgcgagcagggcatccatgtcacctcgtacatgacc
ctggccgtgggcgaagtgctcaaggatccggtaatccaggcgatcgccaggcgccacgac
gccacgccggcgcaggtcacgctggcctgggccctgcagcagggctattcggtaattccg
tcctcgaccaagcgggcgaatctggaaagcaacctcaaggcgcagagcctgcacctgagt
gagcaggacatggccgagatcgccgcgctggaccgtggcgaacgcctggccaacccgaaa
gcgattgcgcccgactgggactga

DBGET integrated database retrieval system