KEGG   Xanthomonas campestris pv. campestris 8004: XC_0287Help
Entry
XC_0287           CDS       T00247                                 

Definition
(GenBank) conserved hypothetical protein
Organism
xcb  Xanthomonas campestris pv. campestris 8004
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1456 DEPP
Motif
Other DBs
NCBI-ProteinID: AAY47373
UniProt: A0A0H2X2Q3
Position
complement(343211..343684)
Genome map
AA seq 157 aa AA seqDB search
MIHNDVLRSIRYMLDLSDDKVVEIAQLADPAFALDKPQVQAWLKKEDEPGFEPCTDAMLA
RFLDGLVLRFRGRDESQPPRPLETPVGNNLVLKKLRVAFELKDVDMHSIFANAGFPLSKP
ELSALFRQPGHKNFRPCGDQLLRAFLKGLTARMREAG
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgattcacaacgatgtactgcgcagcatccgctacatgctcgacctcagcgacgacaag
gtggtggagatcgcccagctggccgaccccgcattcgcgctcgacaagccgcaggtgcag
gcctggctgaagaaggaagacgagcccggtttcgagccctgcaccgatgcgatgctggcg
cgctttctggatggcctggtgctgcgcttccgcggccgcgacgaaagccagccgccgcgc
ccgctggaaacccccgtcggcaacaacctggtgctgaagaagctgcgcgtggccttcgaa
ctgaaggacgtggacatgcactccattttcgccaacgccggtttcccgctgtccaagccg
gaactgtcggcgctgttccgccaacccggccacaagaacttccgcccctgcggcgaccaa
ctgctacgcgccttcctcaagggcctcaccgcccgcatgcgcgaagccgggtaa

DBGET integrated database retrieval system