KEGG   Xanthomonas campestris pv. campestris 8004: XC_0288Help
Entry
XC_0288           CDS       T00247                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K07127  5-hydroxyisourate hydrolase [EC:3.5.2.17]
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Pathway
xcb00230  Purine metabolism
xcb01100  Metabolic pathways
xcb01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:xcb00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    XC_0288
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:xcb02000]
    XC_0288
Enzymes [BR:xcb01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.2  In cyclic amides
    3.5.2.17  hydroxyisourate hydrolase
     XC_0288
Transporters [BR:xcb02000]
 Other Transporters
  Others
   XC_0288
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transthyretin CarboxypepD_reg bMG3
Motif
Other DBs
NCBI-ProteinID: AAY47374
UniProt: A0A0H2X2Z0
Position
complement(343801..344160)
Genome map
AA seq 119 aa AA seqDB search
MATAHAGGGMSTLSTHVLDTAAGRPAAGVTLRLFAGDTLCLEAATDADGRCPALATLHLA
RGRYRLEFDVAGYWQASGTALADPPFLEMVPIVFNLGEHGHYHVPLLLSPYGYSTYRGS
NT seq 360 nt NT seq  +upstreamnt  +downstreamnt
atggccacagcccacgcaggcggtggcatgagcacgctctccacccatgtgctcgacacc
gccgccggccgcccggctgcgggcgtcacgctgcgcctgttcgccggcgacaccctgtgc
ctggaggcggccaccgatgccgacgggcgctgcccggccctggccacgttgcatctggca
aggggccgctaccggctggagttcgacgtggccggctactggcaggccagcggcaccgcg
ctggccgacccgccgttcctggagatggtgccgatcgtcttcaacctaggcgagcatggc
cattaccacgtgccgctgctgctgtcgccgtacggctattccacctatcgcggcagctga

DBGET integrated database retrieval system