KEGG   Xanthomonas campestris pv. campestris 8004: XC_0289Help
Entry
XC_0289           CDS       T00247                                 

Definition
(GenBank) monoxygenase
Organism
xcb  Xanthomonas campestris pv. campestris 8004
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_9 Pyr_redox_3 K_oxygenase DAO Pyr_redox_2 HI0933_like FAD_binding_2 NAD_binding_8 Thi4 GIDA FAD_binding_3 TrkA_N
Motif
Other DBs
NCBI-ProteinID: AAY47375
UniProt: A0A0H2X4F8
Position
complement(344130..345551)
Genome map
AA seq 473 aa AA seqDB search
MSLAQLEHALQHDLQRLAHGGEPWVRPRVHPAGHVYDVVIVGAGQSGLGAAFALQRERVH
NVLVIDENPPGQEGPWVTYARMQTLRTPKQITSIDLGVPTLTFRAWWEAQHGAAGWDALD
KIPRGTWMDYLRWYRAALRLPVRNATQLVRIEPDAAPGIHRLHLAMGAPLMARKIILATG
IQGGGQWQVPEWITQALPAQRYAHTSGPIDYAALAGKRVGILGGGASAFDNACFALDQGV
ARAEVFVRRAALPRVNPIRHMEQAGIIPRFAALPDADKYRMMASFFGRNQPPTNDTFQRA
CAHAGFALHLDAPWLGVEEHNDVVVVRTPQGEHRFDFLAIATGLVTDPRLRPELAALSGR
IACWADRYQAPPGQANPVLDAHPYLGPGFELLPRTPDDAAAVDGLFAFNYSALINHGLSA
AALSGLKVALPRLARAVADQLFLDDRQAMVEAYLGYDQAEFVGQWPQPTQAVA
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgagcctggctcaactcgaacacgcgctgcaacacgacctgcaacgcctcgcccacggc
ggcgaaccctgggtgcgcccgcgcgtgcatccggccggccatgtgtacgacgtggtcatc
gtcggcgccgggcagagcggcctgggcgcggccttcgccctgcaacgcgagcgcgtgcat
aacgtgttggtgatcgacgaaaacccgcccgggcaggagggcccctgggtcacctacgca
cgcatgcagacgctgcgcacgcccaagcagatcacttcgatcgacctgggcgtgcccacg
ctcaccttccgcgcctggtgggaggcgcagcacggcgccgccggctgggacgcgctggac
aagattccgcgcggcacctggatggactacctgcgctggtaccgcgcggcgctgcggctg
ccggtgcgcaatgccacccagctggtgcgcatcgagccagacgccgcgcccggcatccat
cgcctgcacctggcgatgggcgcgccgctgatggcgcgcaagatcatcctggccaccggc
atccagggcggcggccaatggcaggtgcctgagtggatcacccaggccctgccggcgcag
cgctacgcgcatacttccggccccatcgattacgccgcattggccggcaagcgcgtgggc
atcctgggcggcggcgcctcggcgttcgacaacgcctgcttcgcgctggaccagggcgtg
gcgcgtgcggaggtgttcgtgcgccgcgccgcgctgccgcgggtcaacccgatccgccac
atggaacaggccggcatcattccacgcttcgccgccctgcccgacgccgacaagtaccgc
atgatggccagcttcttcggccgcaaccaaccgcccaccaacgacaccttccagcgtgcc
tgcgcgcatgccggttttgcgctgcacctggacgcgccatggctgggcgtggaagaacac
aatgacgtggtggtggtgcgcaccccgcagggcgagcaccgtttcgacttcctggccatc
gccaccggcctggtcaccgacccgcggctgcgcccggagctggccgcgctgtccgggcgc
atcgcctgctgggccgaccgctaccaggccccgcccggccaggccaatccggtgctggac
gcgcacccctacctgggccctggattcgagctactgccccgcacgcccgacgatgccgcc
gcggtggacgggctgttcgccttcaactattcggcgctgatcaaccacggcttgtctgca
gcggcgttatcggggctgaaagtggcgctgccgcggctggcacgggcggtggccgatcag
ctgttcctggacgaccgccaggccatggtcgaggcctacctgggctacgaccaggccgaa
ttcgtcggccaatggccacagcccacgcaggcggtggcatga

DBGET integrated database retrieval system