KEGG   Xanthomonas campestris pv. campestris 8004: XC_0289Help
Entry
XC_0289           CDS       T00247                                 

Definition
(GenBank) monoxygenase
  KO
K22879  FAD-dependent urate hydroxylase [EC:1.14.13.113]
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Pathway
xcb00230  Purine metabolism
xcb01100  Metabolic pathways
xcb01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:xcb00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    XC_0289
Enzymes [BR:xcb01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.113  FAD-dependent urate hydroxylase
     XC_0289
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_9 Pyr_redox_3 K_oxygenase DAO Pyr_redox_2 FAD_binding_2 HI0933_like NAD_binding_8 Thi4 GIDA FAD_binding_3 TrkA_N
Motif
Other DBs
NCBI-ProteinID: AAY47375
UniProt: A0A0H2X4F8
Position
complement(344130..345551)
Genome map
AA seq 473 aa AA seqDB search
MSLAQLEHALQHDLQRLAHGGEPWVRPRVHPAGHVYDVVIVGAGQSGLGAAFALQRERVH
NVLVIDENPPGQEGPWVTYARMQTLRTPKQITSIDLGVPTLTFRAWWEAQHGAAGWDALD
KIPRGTWMDYLRWYRAALRLPVRNATQLVRIEPDAAPGIHRLHLAMGAPLMARKIILATG
IQGGGQWQVPEWITQALPAQRYAHTSGPIDYAALAGKRVGILGGGASAFDNACFALDQGV
ARAEVFVRRAALPRVNPIRHMEQAGIIPRFAALPDADKYRMMASFFGRNQPPTNDTFQRA
CAHAGFALHLDAPWLGVEEHNDVVVVRTPQGEHRFDFLAIATGLVTDPRLRPELAALSGR
IACWADRYQAPPGQANPVLDAHPYLGPGFELLPRTPDDAAAVDGLFAFNYSALINHGLSA
AALSGLKVALPRLARAVADQLFLDDRQAMVEAYLGYDQAEFVGQWPQPTQAVA
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgagcctggctcaactcgaacacgcgctgcaacacgacctgcaacgcctcgcccacggc
ggcgaaccctgggtgcgcccgcgcgtgcatccggccggccatgtgtacgacgtggtcatc
gtcggcgccgggcagagcggcctgggcgcggccttcgccctgcaacgcgagcgcgtgcat
aacgtgttggtgatcgacgaaaacccgcccgggcaggagggcccctgggtcacctacgca
cgcatgcagacgctgcgcacgcccaagcagatcacttcgatcgacctgggcgtgcccacg
ctcaccttccgcgcctggtgggaggcgcagcacggcgccgccggctgggacgcgctggac
aagattccgcgcggcacctggatggactacctgcgctggtaccgcgcggcgctgcggctg
ccggtgcgcaatgccacccagctggtgcgcatcgagccagacgccgcgcccggcatccat
cgcctgcacctggcgatgggcgcgccgctgatggcgcgcaagatcatcctggccaccggc
atccagggcggcggccaatggcaggtgcctgagtggatcacccaggccctgccggcgcag
cgctacgcgcatacttccggccccatcgattacgccgcattggccggcaagcgcgtgggc
atcctgggcggcggcgcctcggcgttcgacaacgcctgcttcgcgctggaccagggcgtg
gcgcgtgcggaggtgttcgtgcgccgcgccgcgctgccgcgggtcaacccgatccgccac
atggaacaggccggcatcattccacgcttcgccgccctgcccgacgccgacaagtaccgc
atgatggccagcttcttcggccgcaaccaaccgcccaccaacgacaccttccagcgtgcc
tgcgcgcatgccggttttgcgctgcacctggacgcgccatggctgggcgtggaagaacac
aatgacgtggtggtggtgcgcaccccgcagggcgagcaccgtttcgacttcctggccatc
gccaccggcctggtcaccgacccgcggctgcgcccggagctggccgcgctgtccgggcgc
atcgcctgctgggccgaccgctaccaggccccgcccggccaggccaatccggtgctggac
gcgcacccctacctgggccctggattcgagctactgccccgcacgcccgacgatgccgcc
gcggtggacgggctgttcgccttcaactattcggcgctgatcaaccacggcttgtctgca
gcggcgttatcggggctgaaagtggcgctgccgcggctggcacgggcggtggccgatcag
ctgttcctggacgaccgccaggccatggtcgaggcctacctgggctacgaccaggccgaa
ttcgtcggccaatggccacagcccacgcaggcggtggcatga

DBGET integrated database retrieval system