KEGG   Xanthomonas campestris pv. campestris 8004: XC_0291Help
Entry
XC_0291           CDS       T00247                                 

Definition
(GenBank) conserved hypothetical protein
Organism
xcb  Xanthomonas campestris pv. campestris 8004
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3225 DUF4440 SnoaL_3 CaMKII_AD Halo_GVPC SnoaL_2 Lumazine_bd_2
Motif
Other DBs
NCBI-ProteinID: AAY47377
UniProt: A0A0H2X4C5
Position
complement(346036..346431)
Genome map
AA seq 131 aa AA seqDB search
MSIDTASIDLPEVIAEVTAAFHAYEHALMHDDIAAMDALFHAAPSTVRYGVGEVLYGSEA
IRAFRIGRGGSPQRQLVHVAVHGFGQDLATTHAEFVREGSTAHGRQSQTWVRFTDGWKVV
AAHVSLQGSHA
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgagcatcgacacggccagcatcgatctgccggaggtgatcgccgaggtcaccgcggca
ttccatgcgtatgagcacgccttgatgcacgacgatatcgccgcgatggatgcgctgttc
catgccgcgccaagcacagtgcgctatggcgtgggcgaagtgctgtacggcagcgaggcg
atccgtgcatttcgcatcggtcgtggcggctcgccgcagcgccagctcgtgcacgttgcg
gtgcacggcttcggccaggatcttgccaccacgcatgcggaattcgtgcgcgagggcagc
accgcgcacggccgccagagccagacctgggtgcgctttaccgatggctggaaagtggtg
gctgcgcacgtctcgctgcaaggcagccacgcatga

DBGET integrated database retrieval system