KEGG   Xanthomonas campestris pv. campestris 8004: XC_0296Help
Entry
XC_0296           CDS       T00247                                 

Definition
(GenBank) oxidoreductase
Organism
xcb  Xanthomonas campestris pv. campestris 8004
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2
Motif
Other DBs
NCBI-ProteinID: AAY47382
UniProt: A0A0H2X4C8
Position
351078..351332
Genome map
AA seq 84 aa AA seqDB search
MYLARELEPRSITANTVARGAIATGFPGGAVRDTPAYTKAFADMTALGRVGVPDDIGPMV
ASLLSEDNRWVTGQRIEVSGGQTI
NT seq 255 nt NT seq  +upstreamnt  +downstreamnt
gtgtatctggccagggagctggaaccgcgcagtatcacggccaacacggtggcgcgcggt
gccattgccactggctttcccggaggtgcggtgcgcgatacgccggcctacaccaaggcc
tttgccgacatgaccgcgttgggccgggtgggcgtgccggacgacatcggcccgatggtc
gccagcctgttgagcgaggacaaccgctgggtcaccgggcagcggatcgaggtgtctggc
ggccagacgatctga

DBGET integrated database retrieval system