KEGG   Xanthomonas campestris pv. campestris 8004: XC_0298Help
Entry
XC_0298           CDS       T00247                                 

Definition
(GenBank) transcriptional regulator
Organism
xcb  Xanthomonas campestris pv. campestris 8004
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 DmpG_comm
Motif
Other DBs
NCBI-ProteinID: AAY47384
UniProt: A0A0H2X321
Position
352897..354093
Genome map
AA seq 398 aa AA seqDB search
MSSASTASAAVRAAPSASRQTWSAVGSLSLCVALLIASEFMPVSLLTPIAADLHATAGMA
GQAISISGLFAVLASLLIAPLTSRFNRRHVLISLSAVMLLSLLLIANAHSFGMLMAARAL
LGITIGGFWALATATVMRMMPEEAVPKALGIVYIGNAVATAFAAPLGSYLGAVIGWRGVF
WGMVPLVALTIAWQWHSLPSLPAQGGTSLGSIAALLKRRYVARAMLAIMLGFAGAFSAFT
YFRPFLENAAHVDVSHLSLLLLGLGLAGFAGTYAATALLPKRLFSLLTVLPVALGVATLA
MLLTSHLLWGVAIAMIAWGTLNSALPVAWSTWLSRCIKDAPEAGGGLMVAAIQLAIMLGG
ALGGVLLDHVSIAATFIGASVLLLAASLVAGNGARLQP
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgtcttccgcatccactgcttccgccgccgtgcgcgctgcgcccagcgccagccgccag
acctggagtgcggtgggctcgttgtcgttgtgcgtagcgttgttgatcgcctccgagttc
atgccggtcagcctgctcacgccgatcgcggccgatctgcatgccaccgccggcatggcc
gggcaggcgatctccatctcggggttgtttgcggtgctggccagcctgctcatcgcgcca
cttacgtcgcgcttcaatcgccggcatgtgctgatcagcctgagcgcggtgatgttgctg
tcattgttgctgatcgccaatgcgcattcgttcggcatgttgatggcggcgcgtgcgctg
ctggggatcaccattggtgggttctgggcgctggccaccgccacggtgatgcgcatgatg
ccggaagaggcggtacccaaggcgctgggcatcgtctacatcggcaacgcggtggcgacc
gcatttgccgctccgttgggtagctatctgggcgcggtgatcggctggcgtggcgtgttc
tggggcatggtgccgttggtggcgctgaccatcgcctggcagtggcacagcctgccatcc
ttgcctgcgcagggcggcacctcgctgggcagcatcgccgcattgctcaagcgtcgctac
gtggcgcgcgcgatgctggcgatcatgttgggctttgccggtgcgttctctgcgtttacc
tatttccgtccgttcctggagaacgccgcgcacgtggatgtatcgcacttgtcgttgctg
ctgctcgggctgggcctggccggttttgccggcacctatgccgccacggccctgctgccg
aagcgcttgttcagtctgctcacggtgctgccggtggcgttgggcgtggccaccctggcg
atgctgctgaccagccatctgctgtggggcgtggcaatcgcgatgattgcgtggggcaca
ctcaattcggcattgccggtggcgtggtccacctggctgagccgctgcatcaaggacgca
ccggaagccggtggcggcctgatggtggccgccatccagctggccatcatgctcggtggt
gcactgggcggcgtgctgctggatcacgtctccatcgccgccaccttcatcggtgccagc
gtgctgctgctggctgcatcgctggtggccggtaatggcgcgcggttgcagccttga

DBGET integrated database retrieval system