KEGG   Xanthomonas campestris pv. campestris 8004: XC_0301Help
Entry
XC_0301           CDS       T00247                                 

Definition
(GenBank) gamma-glutamyltranspeptidase
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Pathway
xcb00430  Taurine and hypotaurine metabolism
xcb00460  Cyanoamino acid metabolism
xcb00480  Glutathione metabolism
xcb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xcb00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    XC_0301
   00460 Cyanoamino acid metabolism
    XC_0301
   00480 Glutathione metabolism
    XC_0301
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:xcb01002]
    XC_0301
Enzymes [BR:xcb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     XC_0301
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione hydrolase
     XC_0301
Peptidases [BR:xcb01002]
 Threonine Peptidases
  Family T3: gamma-glutamyltransferase family
   XC_0301
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-ProteinID: AAY47387
UniProt: A0A0H2X4D1
Position
complement(356337..357917)
Genome map
AA seq 526 aa AA seqDB search
MLHTLRARRGMVVAPHHLAAQAGRDILRAGGNAIEAAVATAACLAVVYPHMTGIGGDGFW
LIHEPDGRVHAIDACGRAAQAATLDFYRGHTHIPWRGPGAANTVAGTVSGWALALQHGGG
TLPLQQLLEEAIHHAEVGVPITLGGAHIAASKGDELRCLPGAYARIFEPRGAPLHEGAVL
QQPQLARTLQRLAHDGLDSFYRGALADDIAADLRVLGSPLHADDLATHTAEASVPLSVAI
AGARLYNHAPPTQGLASLLILALFDRLPATQADSFAHLHGLIEATKQAFLIRDAHIGDSA
WMTLDAQALLDDSAALDALAARIDLHAALPWPQPSQAGDTVWFGAIDAQGRAVSCIQSTY
FEFGSGLVLPHTGITWQNRGCSFRLATDGWNALAPGRKPFHTLNPALATFDDGRVMAYGT
MGGEGQPQTQAALFSRYAHFGMPLQQAITAPRWLLGRTWGDDSTTLKLEDRFDPAVVQAL
RDAGHAVELLPAYSSVMGHAGALVREVTGVVSGASDPRSDGAVAGW
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgctgcacaccttgcgcgcacgccgcggcatggtggtcgcgcctcaccatctggccgcg
caggccgggcgcgacatcctgcgcgccggcggcaacgccatcgaagcagcggtggccacc
gccgcctgtctggccgtggtgtatccgcacatgaccggcatcggcggcgatggcttctgg
ctgatccacgaacccgatggccgcgtacacgccatcgacgcctgcggccgtgccgcacag
gcggccacgctggacttctatcgcggccacacccacatcccctggcgcggcccgggcgcc
gccaataccgtggccggcaccgtctccggctgggcgcttgcgctccagcacggtggtggc
acgctcccgctgcagcagctgctggaagaggccatccaccatgccgaggtgggcgtgccg
atcacgctcggcggtgcgcacatcgccgccagcaagggcgatgaactgcgttgcctgccg
ggcgcctatgcgcgcatcttcgagccgcgcggcgcgcccctgcacgagggcgccgtgctg
cagcaaccccagctcgcgcgcaccctgcaacggctggcgcacgatggcctggacagtttc
taccgcggcgcgctcgccgatgacatcgccgccgacctacgcgtactcggcagcccgttg
catgcggatgacctggccacacacaccgccgaggccagcgtgccgctctcagtcgccatc
gccggtgcacgtttgtataaccacgcaccgcccacgcaagggctggcctcgctgttgatc
ctggcgctgttcgaccgcctgccggccacgcaggcagacagtttcgcgcacctgcatggc
ctgatcgaagccaccaaacaggccttcctgattcgcgacgcccacatcggcgacagcgcc
tggatgacgctcgacgcacaagccctgctcgacgacagcgctgcgctggacgcactggcc
gcccgcatcgacctgcacgcggccctgccctggccgcagccctcgcaggccggcgacacc
gtctggttcggcgccatcgacgcgcagggccgcgcggtgagctgcatccagtccacctat
ttcgaattcggctccggcctggtgctgccgcataccggcatcacctggcagaatcgcggc
tgcagctttcgcctcgccaccgacggctggaatgcactcgccccagggcgtaaaccgttc
cacaccctcaaccccgccctggccaccttcgacgatggccgcgtcatggcctacggcacc
atgggcggcgaaggccaaccgcagacccaggccgcgctgttctcgcgctacgcccacttc
ggcatgccgttgcaacaggccatcaccgcaccgcgctggctgctcggccgcacctggggc
gacgacagcaccacgttgaagctggaagaccgcttcgacccggccgtggtgcaagcactg
cgcgacgccggccacgccgtcgaactgttaccggcctatagctcggtgatggggcatgct
ggcgccctggtgcgtgaggtcaccggcgtggtgagtggtgcgagcgacccaagatcggat
ggtgcggtggctgggtggtga

DBGET integrated database retrieval system