KEGG   Xanthomonas campestris pv. campestris 8004: XC_0306Help
Entry
XC_0306           CDS       T00247                                 

Definition
(GenBank) hypothetical protein
Organism
xcb  Xanthomonas campestris pv. campestris 8004
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AAY47392
UniProt: A0A0H2X4D7
Position
363966..364097
Genome map
AA seq 43 aa AA seqDB search
MDGVGWQRLMRRLQRAVAPRVCLGGKPSVLMSASHTAPGNRNS
NT seq 132 nt NT seq  +upstreamnt  +downstreamnt
gtggatggcgttggttggcaacgcctgatgagaaggttgcagcgcgccgttgcgccacgc
gtgtgcctgggcggcaagccgagcgtgctgatgtctgcatcgcacacggcacccggcaac
cgcaacagctga

DBGET integrated database retrieval system