KEGG   Xanthomonas campestris pv. campestris 8004: XC_0307Help
Entry
XC_0307           CDS       T00247                                 

Definition
(GenBank) vanillate O-demethylase oxidoreductase
Organism
xcb  Xanthomonas campestris pv. campestris 8004
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2 NAD_binding_1 FAD_binding_6 Fer2_4 NAD_binding_6
Motif
Other DBs
NCBI-ProteinID: AAY47393
UniProt: A0A0H2X2S0
Position
complement(364258..365238)
Genome map
AA seq 326 aa AA seqDB search
MTGEDDGMSLHEVRVAEVVDQGHRQRAIRLEPIGAELPAFEAGAHVDLHLPDGLIRQYSI
ASAPHARDHYLLCVKLADASRGGSRHLCEQLAAGDRLQISTPRNLFPLHPGERHVLLAAG
IGITPLLSMVEALEARGEAFVLHYYARRQADVAFGQRLQQGFQHGQVQVHLSDGGESPRV
HIPTELRKAHARDQLYLCGPAAFMDHFSALALAQGWAPAQLHREHFAAVAPAVPHAADDA
FEVELAASGRVVQVAAECSIASALMAAGVEVPLSCEQGMCGACLTGVLDGVPDHRDSVLS
DSEHAQNTQITLCCSRSRTPRLVLEL
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
ttgaccggcgaggatgacggcatgagcctgcatgaggtgcgtgtggcggaagtcgtcgac
cagggacatcgccagcgggcgatccggttggagccgatcggcgcggagttgccggccttt
gaagccggcgcgcatgtggacctgcacctgcccgatggtttgatccgccagtactccatc
gccagcgcgccgcatgcgcgcgaccattacctgttgtgcgtgaagctggccgacgcctcg
cgcggcggctcgcggcatctgtgcgaacaactcgcggccggcgaccggctgcagatctcc
acgccgcgcaacctgttcccgttacacccgggcgaacgccatgtgctgctggcggccggg
atcggcatcactccgctgctgtcgatggtcgaggcgctggaagcgcgcggcgaggccttc
gtgctgcactactacgcacgccggcaggcggatgtggccttcgggcagcgcctgcagcag
ggcttccagcacggccaggtgcaggtgcacctgagcgatgggggcgagagcccgcgtgtg
cacatccccaccgaactgcgcaaggcacacgcgcgcgaccagctgtatctgtgcgggccg
gccgcgttcatggatcacttcagcgcgctggccctggcgcagggctgggcgccggcgcag
ctgcatcgcgaacacttcgccgcggtcgcgccggccgtgccgcacgccgccgacgacgcc
ttcgaagttgagctggccgccagcgggcgcgtggtgcaggtggcggccgagtgcagtatc
gccagtgcgctgatggccgcaggcgtggaggtgccgctgtcgtgcgagcaaggcatgtgc
ggggcctgcctgaccggcgtgctcgatggcgtgcccgatcaccgcgacagcgtgctcagc
gacagcgaacacgcgcagaacacgcagatcaccctgtgctgttcgcgcagccgcacgcca
cggctggtgctggaactttga

DBGET integrated database retrieval system