KEGG   Xanthomonas campestris pv. campestris 8004: XC_0311Help
Entry
XC_0311           CDS       T00247                                 

Definition
(GenBank) conserved hypothetical protein
Organism
xcb  Xanthomonas campestris pv. campestris 8004
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyoxalase
Motif
Other DBs
NCBI-ProteinID: AAY47397
UniProt: A0A0H2X4E2
Position
complement(368490..369167)
Genome map
AA seq 225 aa AA seqDB search
MLAMRLRHLLLPCLDPDLTLRFYRDVLQLPLAGNSVRIGWSTLECVQAQQPVGSVHLAFN
VAPARFDAAAAWVGARAALLTDPHGQERFQLDGVWQSQSVYFAGPDGAVLELIARNALQD
APTGQGAFHGSELLCLSEIGLPSSNVAAVTSSVGHHFGVQPFAPTLEGFAALGDDHGLLI
VVDQARRWFPQQRQLPWASGLRVSVDAPQPGLRLRDAQGWELLAA
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
gtgcttgccatgcgtctgcgtcatctgctgttgccgtgtctggacccggatctcaccctg
cgcttctatcgtgatgtgctgcagctgccgctcgccggcaacagcgtgcgcattggctgg
agcacgttggaatgcgtgcaggcgcagcagccggtgggtagcgtgcatctggccttcaat
gtggcacctgcgcgcttcgatgcggcagctgcctgggtcggcgcacgtgccgcgctgctc
accgacccacatggccaggagcgcttccagctcgatggcgtgtggcaatcgcagtcggtg
tatttcgccggccccgatggcgccgtgctcgaactgatcgcccgcaatgcgctgcaggac
gcacccaccggccagggtgcgtttcacggtagcgaactgctgtgcctgagcgagatcggg
ctgcccagcagcaatgtggctgcggtaaccagcagcgtgggccatcacttcggcgtgcag
ccgtttgcaccgacgctggaagggtttgccgcgcttggcgacgaccacgggctgttgatc
gtggtggaccaggcgcggcgctggtttccgcaacaacgccaactgccgtgggccagcggc
ctacgcgtcagcgtggacgcgccgcagccaggcctgcgattgcgcgatgcacagggctgg
gaattgctggcggcgtaa

DBGET integrated database retrieval system