KEGG   Xanthomonas campestris pv. campestris 8004: XC_0313Help
Entry
XC_0313           CDS       T00247                                 

Definition
(GenBank) MFS transporter
  KO
K08224  MFS transporter, YNFM family, putative membrane transport protein
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Brite
KEGG Orthology (KO) [BR:xcb00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:xcb02000]
    XC_0313
Transporters [BR:xcb02000]
 Major Facilitator Superfamily (MFS)
  Drug transporters
   Acriflavin-sensitivity (YnfM) family [TC:2.A.1.36]
    XC_0313
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 Sugar_tr MFS_1_like
Motif
Other DBs
NCBI-ProteinID: AAY47399
UniProt: A0A0H2X336
Position
370684..372033
Genome map
AA seq 449 aa AA seqDB search
MDAATIIYWTGGGPGDILAVPRLGCAPVSSSDCRPGALSAAALPADTPATGRIRLALFLA
GFATFSLLYSVQPVLPEFARTFGVDAATASLPLSLATGALAIAIFCAGAVSENLGRRGLM
FVSIALAAVLNLIAAFLPHWGALVAVRTLSGIALGGVPAVAMVYLAEELPASKLGAATGL
YVAGNAFGGMSGRIVMSLLTDHYDWRTALAVLSVFDLLCAVAFVWLLPPSRHFVRRHGVN
LHYHLRAWGGHLRNRQLLWLFSIPFLLMGVFVSVYNYAGFRLGGAEYGLSQSQIGMIFSA
YVFGIVSSSVAGAASDRYGRGPVVLAGTLTAAAGVALTLAHALPVVIAGVVLLTIGFFIA
HSSASAWVGRLGGAARSHAASLYLLAYYSGASLVGAVSGWFWQHGGWGALVAFCGSLLAL
ALLAAQVLRRSADDSRPYGRFAPHPPRGE
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atggacgctgcgacaatcatatattggacagggggtgggccgggggacattctggccgtc
ccacgtctcggttgcgctcctgtgtcttcctccgattgccgccccggcgccctgtccgcc
gccgccctgcccgcagacacgccggcaaccggccgcatccgcctggcgttgttcctggcc
ggctttgccaccttctcgctgctgtacagcgtgcagccggtgctgccggaatttgcccgc
accttcggtgtggatgcggccacggcctcgttgccgttgtcgctggcgaccggtgcgctg
gcgattgcgatcttctgtgccggtgcggtgtcggagaatctgggccggcgcgggctgatg
tttgtctccatcgcgctggccgcagtgctcaacctgatcgccgccttcctgccgcactgg
ggcgcgctggtggcggtgcgcaccttgtccggcatcgcgctgggcggggtgccggcggtg
gccatggtctatctggccgaagagctgccggccagcaaactgggcgcggccaccgggctg
tacgtggccggtaacgcgtttggcggcatgagcgggcgcatcgtgatgagcctgctcacc
gaccactacgactggcgtaccgcgctggcagtgttgagcgtgttcgacctgctgtgcgcg
gtggcgttcgtgtggctgctgccgccctcgcgtcacttcgtgcgccggcacggcgtcaac
ctgcactaccacctgcgcgcctggggcgggcatctgcgtaaccgccagttgttgtggctg
ttctcgatcccgttcctgttgatgggcgtgttcgtcagcgtctacaactacgccgggttc
cgcctgggcggcgcggaatacggcctgagccagagccagatcggcatgatctttagcgcg
tacgtgttcggcatcgtgtcttcatcagtggccggtgcggcttcggaccgctacggccgg
ggcccggtggtgctggccggcacgctcaccgccgcggccggtgtggcgttgacgctggcg
catgccttgccggtggtgattgccggggtagtgctgctgacgatcgggtttttcattgcg
cattcgtcggccagcgcctgggtgggccggctgggcggtgcggcgcgtagccatgcagcg
tcgttgtatctgctggcctactacagcggtgccagcctggtcggcgcggtcagcggctgg
ttctggcagcacggcggttggggtgcgctggtggcgttctgcggcagcttgctcgccctg
gccttgctggcggcgcaggtactacgccgcagtgcggacgactcgcgcccgtatgggcgc
tttgcgccacatccaccgcgcggggagtaa

DBGET integrated database retrieval system