KEGG   Xanthomonas campestris pv. campestris 8004: XC_0314Help
Entry
XC_0314           CDS       T00247                                 

Definition
(GenBank) conserved hypothetical protein
Organism
xcb  Xanthomonas campestris pv. campestris 8004
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: S1-P1_nuclease
Motif
Other DBs
NCBI-ProteinID: AAY47400
UniProt: A0A0H2X4I0
Position
complement(372234..373262)
Genome map
AA seq 342 aa AA seqDB search
MKPSLLAAAVLLTACFAPTAALAWGKRAHAAIDSAALQALPDDGPVFLKRHVQVIADGAV
LPDGWRSESEPFLKIEEDPNHGWFREQFAFMANPPRSRYAFVLALYDEQRRLAQRDPAAA
ERMNVRWAGTLPYAATEGYERIVATMRQIRALRAAGEDTRELERTCAFLVSWFAHYIGDG
AQPQHDSIHHDGWQGPNPHGYSTDPKVHGKFESDYIDKIALTPQDLLTRMPALAHHDGDV
FEQLLGFLAIGTGRVEQVYRLEKAGAFDDASRTDGRAMVYLTAGDGAAMLRDLLVRAWRE
SALQPVPVRGPRSMDPAHPQYDPSTGSAPAPRSPALPSTQTQ
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaagccttccctgcttgctgcggccgtcctgctgacggcctgcttcgcccccacggct
gcgctggcctggggaaaacgcgctcacgcggcgatcgatagcgccgccctccaggcactg
ccggatgacgggccggtgtttctcaagcgccatgtgcaggtgattgccgatggtgcggtg
ctgcccgatggctggcgtagtgaaagcgagccgttcctcaagatcgaagaagatcccaac
cacggctggttccgcgagcagttcgcattcatggccaacccgccgcgctcgcgctatgcc
ttcgtgctggccttgtacgacgaacagcggcgccttgcacaacgcgacccggccgccgcc
gagcgcatgaatgtgcgctgggccggcaccttgccgtatgcagccaccgaaggctacgaa
cgcatcgttgccaccatgcgccagatccgcgcgttgcgtgcggccggtgaggacacgcgc
gaactggagcgcacctgcgcgttcctggtgagctggtttgcgcactacatcggcgacggc
gcgcagccgcagcacgacagcatccaccacgatggctggcagggacccaatccccacggc
tacagcaccgacccgaaggtgcacggcaagttcgagagcgactacatcgacaagatcgcg
ctcactccgcaggacttgctgacccgcatgccggccttggcgcatcacgacggcgatgtg
ttcgagcagttgctgggttttctcgccatcggcaccggccgcgtcgagcaggtgtatcgc
ctggaaaaagccggtgcgttcgacgatgcctcccgcaccgacggccgcgcgatggtctac
ctcaccgccggcgacggcgcggcaatgctgcgcgatctgctggtgcgcgcctggcgcgaa
agcgcgctgcagccggttcccgtgcgcgggccgcgcagcatggatccggcgcatccgcag
tacgaccccagcaccggcagcgcgcctgcgccgcgctcaccagcattgccttcaacgcaa
acgcagtaa

DBGET integrated database retrieval system