KEGG   Xanthomonas campestris pv. campestris 8004: XC_0315Help
Entry
XC_0315           CDS       T00247                                 

Definition
(GenBank) TonB-dependent receptor
Organism
xcb  Xanthomonas campestris pv. campestris 8004
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TonB_dep_Rec
Motif
Other DBs
NCBI-ProteinID: AAY47401
UniProt: A0A0H2X3B4
Position
complement(373331..374215)
Genome map
AA seq 294 aa AA seqDB search
MARTTGTLGMPDTLADDAARLFTGARTQTALDVGVTNWTAGFNYDLTPIVGVYGRASRAH
RAPSEGANEGNVNIPTAEQYELGTKLNFATLDVFATAFYTKYDPYNIGTSAVNPLTGAAE
SKDYRGSVTNPGVEVAAVWTPAQWLRLDANVTYNDTKVSDLTEVVANGAVAVVDVDGNMP
NRQPKLYGNVGPTLLFSTGAFDWDTSLRYAYVGKRYADLENTTELAAYHTLAANILVRNG
PWDVQLAVDNLTNAFALTEGNPRTDTISGQGTREPIYGRPIYERNTRLVVTYHF
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atggcccgcaccaccggcacgttgggcatgccagacaccctggccgacgatgccgcacgg
ctgttcaccggtgcccgcacgcagaccgcgctggatgtgggcgtgaccaactggaccgcc
ggcttcaactacgacctcaccccgattgtcggtgtctacggccgcgcctcgcgtgcgcac
cgcgcgcccagcgagggcgccaacgaaggcaacgtcaacattcccaccgccgagcagtac
gagctgggcaccaagctcaacttcgccacgctggatgtgttcgccacggccttctacacc
aagtacgacccgtacaacatcggcaccagcgcggtgaatccgttgactggtgcggccgag
tccaaggattaccgtggcagcgtcaccaacccgggcgtggaagtggccgcggtgtggacg
ccagcgcagtggctgcgcctggatgccaatgtcacctacaacgacaccaaggtctccgac
ctgaccgaagtggtggccaacggcgcggtggcggtggtcgatgtggacggcaacatgccc
aaccgccagcccaagctctatggcaacgtcgggcccacgctgctgttcagcaccggcgca
ttcgattgggatacctcgctgcgctacgcctacgtgggcaagcgctacgccgacctggaa
aacaccaccgaactggccgcctatcacacgctggcggccaacatcctggtgcgcaacggg
ccgtgggatgtgcagctggcggtggacaatctcaccaacgcctttgcgctgaccgaaggc
aacccgcgcaccgataccatctccgggcaaggcacgcgcgaacccatctacgggcggccg
atctacgagcgcaacacccggctggtggtgacctaccacttctga

DBGET integrated database retrieval system