KEGG   Xanthomonas campestris pv. campestris 8004: XC_0318Help
Entry
XC_0318           CDS       T00247                                 

Definition
(GenBank) SIR2-like regulatory protein
Organism
xcb  Xanthomonas campestris pv. campestris 8004
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SIR2 zf-TFIIB
Motif
Other DBs
NCBI-ProteinID: AAY47403
UniProt: Q4UZX0
Position
376475..377356
Genome map
AA seq 293 aa AA seqDB search
MTVAITQTGPALQEFVERHQRLFVLSGAGCSTDSGIPDYRDLQGGWKRPQPVTFQAFMGE
LSTRQRYWARSLVGWPRFGLARPNATHHALAALEARGQLELLLTQNVDRLHQAAGSQAVI
DLHGRLDVVRCMGCEQRMPRTEFQLLLERDNPGWADLEAAQAPDGDADLDNVAFDNFVVP
ACPACGGVLKPDVVFFGENVPRERVERAFAHLQAADAVLVVGSSLMVYSGFRFVQAAARA
GLPIAALNFGRTRADDLLSLKVEQSCAQALAFLQQPPDPLHTATARYHSARSA
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgactgttgcgatcacgcagaccggcccggcgctgcaggagttcgtcgagcgccatcag
cgcttgttcgtactcagcggcgcgggctgcagcaccgattcgggcattcccgattaccgc
gatctgcagggcggctggaagcgcccgcaaccggtgaccttccaggcgttcatgggcgag
ctgtccacgcgccagcgctattgggcgcgcagcctggtgggctggccgcgcttcggcctg
gcgcggcccaacgccacccatcacgccctggccgcgttggaggcgcgcgggcaactggag
ttgctgctcacccagaacgtggaccgcctgcatcaggccgccggcagccaggcggtgatc
gatctgcacggccggctcgatgtggtgcgttgcatgggctgcgaacaacgcatgccgcgc
accgagttccagttgctgctggagcgcgacaaccccggctgggccgacctggaggccgcc
caggcgcccgatggcgatgccgatctggacaacgtggccttcgacaacttcgtggtgccg
gcctgcccggcgtgcggcggcgtgctcaagccggatgtggtgttcttcggcgagaacgtg
ccgcgcgagcgcgtggagcgcgcctttgcgcatctgcaggccgccgatgcggtgctggtg
gtggggtcttcgttgatggtgtattccggcttccgcttcgtgcaggccgccgcacgtgca
ggcctgccgatcgccgcgctcaacttcgggcgcacccgtgccgacgacctgctcagcctg
aaggtggagcaatcctgcgcgcaggcgctggcgttcctgcaacagccgccggaccccctg
cacacggccaccgccaggtaccacagtgcgcgttcggcatga

DBGET integrated database retrieval system