KEGG   Xanthomonas campestris pv. campestris 8004: XC_0322Help
Entry
XC_0322           CDS       T00247                                 

Definition
(GenBank) formyltetrahydrofolate deformylase
  KO
K01433  formyltetrahydrofolate deformylase [EC:3.5.1.10]
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Pathway
xcb00630  Glyoxylate and dicarboxylate metabolism
xcb00670  One carbon pool by folate
Brite
KEGG Orthology (KO) [BR:xcb00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    XC_0322
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    XC_0322
Enzymes [BR:xcb01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.10  formyltetrahydrofolate deformylase
     XC_0322
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Formyl_trans_N ACT ACT_6
Motif
Other DBs
NCBI-ProteinID: AAY47407
UniProt: A0A0H2X3C0
Position
380413..381282
Genome map
AA seq 289 aa AA seqDB search
MAIISPMRSDYILTLSCPDRTGIVYRVTGLLFDLACNILDAQQFGDDESGRFFLRVHFDK
PPRTDIAQLEQQFSQLAAGFEMTWQLHDARRRARLLVLVSKQGHCLNDLLFRMHSRQLPV
DIVAVVSNHTDFAPLAASYGIAFHHLPVSADTRAEQETQLLALVERLQVDLVVLARYMQI
LSPALCRALAGRAINIHHSFLPSFKGAQPYHQAHARGVKIIGATAHYVTEDLDEGPIIEQ
DVARVDHAMTPRDLVRLGSDTESLVLARAVRRHVEHRIVLNGHRTVVFR
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
ttggctatcatctcgccgatgcgctctgactacatcctcaccctgtcctgccccgaccgt
accggcatcgtctatcgcgtgaccggtctgttgttcgatcttgcctgcaatattctcgac
gcccagcaatttggcgacgacgagagcgggcggtttttcctgcgcgtgcatttcgacaag
ccgccgcgaactgacatcgcgcagctggagcaacagttctcacagctggccgccggtttt
gaaatgacctggcagctgcacgatgcgcgccgccgcgcgcggctgctggtgctggtgagc
aagcagggccactgcctcaacgatctgctgttccgcatgcatagccggcagttgccggtg
gatatcgtggcggtggtctccaaccacaccgacttcgcaccgctggcggcgtcctacggc
atcgccttccaccacctgccggtgagcgcagacacgcgcgccgaacaggaaacgcagctg
ctcgcgctggtcgagcgcctgcaggtggacctggtagtgctggcgcgctacatgcagatc
ctttcgcctgcactgtgccgcgcattggccgggcgtgcgatcaacatccaccacagcttc
ctgcccagtttcaagggcgcccagccgtatcaccaggcgcacgcgcgcggggtcaagatc
atcggcgccaccgcgcactacgtcaccgaagacctggacgaaggcccgatcatcgaacag
gacgtcgcccgcgtggaccacgccatgaccccgcgcgacctggtgcgcctgggcagcgac
accgaatcgctggtgctggcacgcgcggtacgccgccatgtcgaacaccgcatcgtgctc
aacgggcaccgtacggtggtgtttcgctag

DBGET integrated database retrieval system