KEGG   Xanthomonas campestris pv. campestris 8004: XC_0326Help
Entry
XC_0326           CDS       T00247                                 

Definition
(GenBank) 5,10-methylenetetrahydrofolate reductase
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Pathway
xcb00670  One carbon pool by folate
xcb01100  Metabolic pathways
xcb01120  Microbial metabolism in diverse environments
xcb01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:xcb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    XC_0326
Enzymes [BR:xcb01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     XC_0326
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTHFR
Motif
Other DBs
NCBI-ProteinID: AAY47411
UniProt: A0A0H2X4J1
Position
complement(385999..386871)
Genome map
AA seq 290 aa AA seqDB search
MSPDPPSRAATITDAYSLEVGAHDMPALTAAAPQIMRGSSMFIPYLPSQNDDARLAAAQR
VRALGFAPMPHLSARRIASRYALQAFVRRAVDEAGVERCLVIAGDAPSAVGPFSDSVSLI
ETGVFERSGIKAIGVAGHPEGHPSMPASAQWDVLERKCRSIAERGMAPLIVTQFAFDADT
VLTWLEALRARGIAHPVHVGVPGPAGVAVLARYAARCGVGACASMLSKYGISLGKLFGTA
GPDRFVDRLTAGLSEAHGDVSLHFYPFGGIAQSVAWVEQYRSRHARPLAD
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgtccccggatccccccagccgcgccgccaccatcaccgatgcttattcattggaggtc
ggcgcacacgacatgccggcgctgactgcagcagcgccgcagatcatgcgcggctcaagc
atgttcattccctacctgcccagccagaacgacgatgcgcgactggccgccgcacagagg
gtgcgcgccctcggcttcgcgcctatgccgcacctgtctgcgcggcgcatcgcctcgcgc
tacgcgctacaggcgttcgtcaggcgcgccgtcgatgaggccggcgttgaacgttgcctg
gtgatcgcgggtgatgcgccgtctgcggttgggccgttttccgatagcgtgtcgctgatc
gagacaggcgtgtttgagcgctcgggcatcaaggccatcggcgtggccggacatccggaa
ggccatccgagcatgcctgcaagcgcgcagtgggatgtgcttgaacgcaagtgccgcagc
attgccgagcgcggcatggcgccgctgatcgtcacccaattcgcgttcgatgccgacact
gtgctgacgtggttggaggcgctgcgcgcgcgtggcattgcccatcccgtgcatgtgggc
gtgccgggtcctgcgggcgtcgcagtgctcgcacgctatgccgcacggtgcggtgttggc
gcatgtgcatcgatgctctccaagtacggcatctcgctcggcaagctgttcgggactgcg
gggccggatcgctttgtggatcgcctcaccgccggcctcagcgaagcgcatggagacgtc
agcctgcacttctatccattcggcggcatcgcacagtctgtcgcgtgggttgagcagtac
cgctcccgccacgcgcgtccattggcggactga

DBGET integrated database retrieval system