KEGG   Xanthomonas campestris pv. campestris 8004: XC_0328Help
Entry
XC_0328           CDS       T00247                                 

Definition
(GenBank) NADH-dependent FMN reductase
  KO
K00299  FMN reductase [EC:1.5.1.38]
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Pathway
xcb00740  Riboflavin metabolism
xcb00920  Sulfur metabolism
xcb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xcb00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    XC_0328
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    XC_0328
Enzymes [BR:xcb01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.38  FMN reductase (NADPH)
     XC_0328
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FMN_red Flavodoxin_2 Flavodoxin_5
Motif
Other DBs
NCBI-ProteinID: AAY47413
UniProt: A0A0H2X4F7
Position
388002..388583
Genome map
AA seq 193 aa AA seqDB search
MPHPLRIVAVSGGMQRPSKAAALAEHLLALIAAQVPCEQHLVELGALAPQFAGALWRSQL
SATVEQELVAVEQADVLVVTTPVYRGSFTGLFKHFFDFVHQDALIDTPVLLAATGGSERH
ALVIDHQLRPLFSFFQARTLPLGVYATDRDFLDYRVHNEALAERARLAVQRALPLIAVTR
QASAIAKENVAAA
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
gtgccacacccactccgcatcgttgcggtgtccggcgggatgcaacgcccctccaaggcg
gccgctctggccgagcacctgctggcattgatcgccgcgcaggtgccgtgcgaacagcat
ctggtggaactcggggcattggcaccgcagttcgcgggtgcgctctggcgctcccagctg
tccgcaacggtggagcaggaactggtcgcggtggagcaggccgatgtgctggtggtgacc
acgccggtgtatcgcggctccttcaccgggttgttcaagcacttcttcgacttcgtccat
caagatgccttgatcgacacgcccgtcctgttggcggccaccggtggcagcgagcggcat
gcgttggtgatcgaccaccagctgcggccgctcttcagttttttccaggcccgcacgttg
ccgctgggcgtctatgcaaccgaccgggattttctggactaccgcgtgcacaacgaggcc
ctggccgaacgcgccaggctagcggtgcagcgggcattgccgctgatcgcagtgacgcgg
caggccagcgccatcgcaaaagaaaacgtggccgcggcttga

DBGET integrated database retrieval system