KEGG   Xanthomonas campestris pv. campestris 8004: XC_0333Help
Entry
XC_0333           CDS       T00247                                 

Definition
(GenBank) oxidoreductase
  KO
K19267  NAD(P)H dehydrogenase (quinone) [EC:1.6.5.2]
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Pathway
xcb00130  Ubiquinone and other terpenoid-quinone biosynthesis
xcb01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:xcb00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    XC_0333
Enzymes [BR:xcb01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.2  NAD(P)H dehydrogenase (quinone)
     XC_0333
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NmrA NAD_binding_10 3Beta_HSD Epimerase KR NAD_binding_4 SUKH-4
Motif
Other DBs
NCBI-ProteinID: AAY47418
UniProt: A0A0H2X4G2
Position
complement(394602..395489)
Genome map
AA seq 295 aa AA seqDB search
MAHTSPLILVTGASGHLGALIVDALLERVPAGRIVATARETASLSAFAKRDISVRRADYA
DPASLDAAFAGVGTVLLVSSNAVGARVEQHRNVIEAAKRAGVGLLAYTSVLRADTSTLSL
AGEHVTTEALLRDSGVPHVLLRNGWYTENYTGSIGPELAHGAVIGSSGDGRISAATRADY
AAAAAAVLASAEPQAGRIYELAGDQAFSMADYAAELAQQAGKPVAYHDMPEADYAAALVQ
AGLPAGFAQVLAQCSASAGGGSLFDDSHTLSKLIGRPTTPLRATIAAALAAQPAG
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atggcacacacctcccccctgattcttgtcaccggcgccagcggacacctgggagcgctg
atcgtcgatgcgttgcttgagcgtgtgcctgccggccgcatcgtagcaaccgcgcgcgag
accgcgtcactgtcggcattcgcaaaacgcgacatcagcgtacgtcgcgccgattacgcc
gacccggcctcgctggacgccgctttcgccggggtcggcacggtcctgctggtgtcctcc
aacgcggtgggcgcgcgcgtggagcagcaccgcaacgtgatcgaggccgccaagcgtgcc
ggcgtgggcctgctcgcctacaccagcgtgctgcgtgcggacaccagcacgctctcgctg
gccggcgagcacgtgaccaccgaagcactgctgcgcgacagcggcgtgccgcacgtgctg
ctgcgtaacggttggtacaccgagaactacaccggctcgatcggcccggaactggcgcac
ggcgcggtaatcggcagctctggcgatggcaggatcagcgcggcaacccgtgccgactac
gcggccgccgcggcggcagtactggcctccgccgaaccgcaggccggacgcatctacgag
ctggcaggcgatcaagccttcagcatggccgactacgccgccgagctggcgcagcaggcg
ggcaagccggtggcctaccacgacatgccggaggcggactatgccgcggccctggtccag
gccgggctgccggccggcttcgcccaggtactggcgcagtgctcggcgtccgcaggcggc
ggcagcctgttcgacgacagccacaccttgagcaagctgatcggccgccccaccaccccg
ctgcgcgccaccattgccgctgcgttggcggcgcagccggcgggctga

DBGET integrated database retrieval system