KEGG   Xanthomonas campestris pv. campestris 8004: XC_0335Help
Entry
XC_0335           CDS       T00247                                 

Definition
(GenBank) conserved hypothetical protein
Organism
xcb  Xanthomonas campestris pv. campestris 8004
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF5308
Motif
Other DBs
NCBI-ProteinID: AAY47420
UniProt: A0A0H2X357
Position
396723..397223
Genome map
AA seq 166 aa AA seqDB search
MSLVGSSSPAARRTAGVALLALWCGWIAVAWTTPQAAAAGDAASAWARVQASLPALSTAP
MLVGVVGACTCDGAADARAWALLSQAVRARGGRVQQIDVPALHGSGYAVWLLGADGQPRY
AGPAQGSAVCGRAGAAEWPRWLPQVLARPADVALVAPCACAAGVSA
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgtccttagtcggttcctcctcacccgccgcccggcgtaccgccggcgtcgccttgctg
gcgctgtggtgcggttggatcgccgttgcctggaccacgccgcaggctgctgctgccggc
gacgccgccagcgcctgggcgcgcgtgcaggccagcctgccggcgctgtcgaccgcacca
atgctggtcggcgtcgtgggtgcctgcacctgcgacggcgccgccgatgcacgtgcctgg
gcgttattgagccaggcggttcgcgcgcgcggcgggcgcgtccagcagatcgatgtgccg
gccctgcatggcagcggctatgcggtgtggctgctcggcgccgatggccagccgcgctat
gcgggccccgcgcagggcagcgcggtatgcgggcgtgccggtgcggcagagtggccgcgt
tggctaccgcaggtcctggcacgcccggcggatgtcgcgctggtggcaccgtgcgcctgt
gctgcgggggtgtcggcatga

DBGET integrated database retrieval system