KEGG   Xanthomonas campestris pv. campestris 8004: XC_0336Help
Entry
XC_0336           CDS       T00247                                 

Definition
(GenBank) chemotaxis protein
  KO
K05874  methyl-accepting chemotaxis protein I, serine sensor receptor
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Pathway
xcb02020  Two-component system
xcb02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:xcb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    XC_0336
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    XC_0336
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:xcb02035]
    XC_0336
Bacterial motility proteins [BR:xcb02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    XC_0336
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MCPsignal PAS_4 PAS E2F_TDP Med11 PAS_8 DUF1659
Motif
Other DBs
NCBI-ProteinID: AAY47421
UniProt: A0A0H2X4K1
Position
397523..399331
Genome map
AA seq 602 aa AA seqDB search
MHFGVFVILALLLYYRDWLPVVVAAAAIAVHHLAFYWLQARGLPVQAFSAGSGFGIVVLH
AGYVIVETAFVCVMAVQLRRQLDALDHEAEALAQLADTLAKGDALPPAIMQQHFRAGSLA
QALVRMSAQVQERITTQQQLLQENRRIRLALDASAMAVAIVDTQGDAIYRNHSFAQLSAR
SDAHTVQQALAEAAQRRAVESGAGARALGALQLQESVTPVHDHDGTPLGVVVEWQDRTQS
LLLEAQLTTVIAQATRGELGARLHGHAHDSTLGQLAEGINRFLAVTEDSLQDMRRMLAAL
AHGDLSQRIDRPCEGVFDHMKRDANATADALARIIVQIRSSSGAINAATGHILHGNDALE
QQVRRQSITLGEAAQQMQAVLGTMQQHSAQAADADVLAAAASEAARAGGDTMGKAMGTMQ
QMEAASRRIQDIIAVIDGLAFQTNILALNAAVEAARAGDEGRGFAVVASEVRALALRSST
AASQIKALIGESVAHVEAGVQQVRSAGAGMQHIVTTIGQVSSTLSTIAVASEQEAGSIAQ
VHQTLSRVDIDMRDGVLRMQEASTAARAMGDHAAQLEDAVSLFVEDAAPTAQSAARQARH
AA
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atgcacttcggcgtcttcgtgatcctggcgctgctgttgtattaccgcgactggctgccg
gtggtggtagccgccgctgcgattgccgtgcaccacctcgcgttttactggctgcaggcg
cgtggtctgccggtgcaggccttcagtgccggcagcgggttcggcatcgtcgtgctgcac
gccggctacgtgattgtggaaaccgccttcgtctgcgtcatggccgtgcaactgcgacgc
cagctggacgcgctggaccacgaagcagaggcgctggcgcagcttgccgacacgctggcc
aagggcgacgccttgccgcctgccatcatgcagcagcactttcgtgccggttcgctggcg
caggcgctggtgcgcatgagcgcgcaggtgcaggaacgcatcaccacgcaacagcagctg
ctgcaggaaaaccgccggattcgcctggcactggatgcctcggccatggctgtggccatt
gtcgacacgcagggcgatgcgatctaccgcaatcactccttcgcacaattgagcgcgcgc
agcgatgcacacaccgtgcagcaggcgcttgccgaggccgcacagcggcgtgctgtcgaa
agtggcgcaggtgcgcgcgcgctgggcgcactgcagctgcaggagagcgtcacgcccgtg
cacgatcacgacggcacgccactgggcgtggtggtggaatggcaggaccgcacccagtcc
ttgttgctcgaagcgcaactgaccaccgtgattgcgcaagccacccgcggcgagctcggc
gcgcggctgcatgggcatgcgcacgacagcaccttgggccagctggccgaaggcatcaat
cgctttctcgcggttaccgaagacagcttgcaggacatgcggcgcatgctggcggcactg
gcgcacggcgacctgtcgcaacgcatcgatcgcccctgcgagggcgtgttcgaccacatg
aagcgcgatgccaatgccacggccgatgcgcttgcccgcatcatcgtgcagatccgcagt
tccagcggcgccatcaatgcggccaccggccacatcctgcacggcaacgacgcactggag
cagcaggtgcggcgccaatcgatcacgctgggcgaggcggcgcaacagatgcaggccgtg
cttggcaccatgcagcagcacagtgcgcaggcagccgatgccgatgtgctggctgccgcc
gcatcggaagcggcacgtgcaggcggcgacaccatgggcaaggcgatgggcaccatgcaa
cagatggaagccgcctcgcggcgtatccaggacatcatcgccgtcatcgatgggttggcc
ttccagaccaacatcctggcgctcaacgctgccgtggaagcggcgcgtgcaggcgacgaa
ggtcgtggctttgcggtggtggccagcgaagtacgcgcgctggcactacgctcctccacc
gccgccagccagatcaaggcgttgatcggcgagtcggtggcgcacgttgaagcaggtgtg
cagcaagtacgcagcgctggtgccggcatgcagcacatcgtgaccaccattggccaggtg
agcagcacgctgagcacgattgcggtcgcctccgagcaagaggccggcagcatcgcgcag
gtgcatcagaccttgagtcgcgtggatatcgacatgcgcgacggcgtgctacgcatgcag
gaggccagcaccgccgcgcgtgccatgggcgaccatgccgcacagctggaagatgcagtg
agcctttttgtggaagacgcagcgcccacagcgcagagtgctgcaagacaggcacgccat
gccgcgtga

DBGET integrated database retrieval system