KEGG   Xanthomonas campestris pv. campestris 8004: XC_0338Help
Entry
XC_0338           CDS       T00247                                 

Definition
(GenBank) conserved hypothetical protein
Organism
xcb  Xanthomonas campestris pv. campestris 8004
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF5329 LisH
Motif
Other DBs
NCBI-ProteinID: AAY47423
UniProt: A0A0H2X4G8
Position
complement(399896..400273)
Genome map
AA seq 125 aa AA seqDB search
MKNKVWLICLLVSGSAFAQGVAPATTREINQLFAALKNSNCEFSRNGSWYSAPKASEHLQ
RKYDYLQKKGLVTSTESFIELAATKSSMSGKPYEVRCGGAAAVPSQSWFTGKLRALRKGT
PASGS
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgaagaataaagtgtggctcatctgcttgctggtgtcgggatcggcgtttgcgcagggc
gtagctcctgccacgacacgggagatcaaccaactgttcgcagcgttgaagaactccaac
tgcgagttctcgcgcaacgggtcgtggtattcggcgcccaaggccagcgagcatttgcaa
cgcaagtacgactacctgcagaagaagggcctggtcaccagcaccgaatcctttatcgaa
cttgctgcgaccaagagcagcatgtcgggcaagccgtacgaggtgcgatgtggcggggca
gcggcggtaccgagccaatcctggttcaccggcaagctgcgcgcattacgcaagggcacg
ccggcctccggcagttga

DBGET integrated database retrieval system