KEGG   Xanthomonas campestris pv. campestris 8004: XC_0339Help
Entry
XC_0339           CDS       T00247                                 

Definition
(GenBank) conserved hypothetical protein
Organism
xcb  Xanthomonas campestris pv. campestris 8004
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyoxalase_6 Glyoxalase
Motif
Other DBs
NCBI-ProteinID: AAY47424
UniProt: A0A0H2X2U7
Position
complement(400508..400894)
Genome map
AA seq 128 aa AA seqDB search
MSQAASSGLFIYAKDLERVAAFYQRVLGMQAIHSSKELVVLNAAALQLVIHAVPEAIAAS
ITIADPPNRRENTALKFFFTVPSIAQLVELAAALGGEILPAQWRGPGFVACNAVDPEGNV
SQLRERAA
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaagctgccagctccggcctgtttatctatgccaaggatcttgagcgtgtggcg
gctttttaccagcgcgtgctgggtatgcaggcgatccattccagcaaggaattggttgtg
ctgaacgcagccgcgctgcaacttgtcatccatgccgtacctgaggcaatcgccgcctcc
atcaccatcgccgatccgcccaaccggcgtgagaacaccgcgctcaagttctttttcacc
gtcccgagcatcgcgcagctcgtcgagcttgcagctgcgcttggcggcgaaattctgcca
gcgcagtggcgcggccctggcttcgttgcctgtaatgccgttgacccggaaggcaatgtc
tcccagctgcgcgaacgcgctgcctag

DBGET integrated database retrieval system