KEGG   Xanthomonas campestris pv. campestris 8004: XC_0340Help
Entry
XC_0340           CDS       T00247                                 

Definition
(GenBank) conserved hypothetical protein
Organism
xcb  Xanthomonas campestris pv. campestris 8004
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Zn_Tnp_IS1595
Motif
Other DBs
NCBI-ProteinID: AAY47425
UniProt: A0A0H2X361
Position
complement(401192..401443)
Genome map
AA seq 83 aa AA seqDB search
MEDHIAGSPAALTEPDPEQLHALEERLPLAPDGSAYRYMNPFRCPHCAAPYIDFAAHPGL
RKNEYYGNYFVGSDLLRYTPADP
NT seq 252 nt NT seq  +upstreamnt  +downstreamnt
gtggaggaccacattgccggcagtccggccgcattgacagagccggaccccgagcagctg
catgcactggaagaacggcttccgctggcaccggatgggtcggcctatcgctatatgaat
ccgttccgctgcccacactgcgctgcgccctatatcgactttgcagcacaccccggcctt
cgaaagaacgagtactacggcaactactttgtcggcagcgatctgctgcgatatacgcca
gccgatccctga

DBGET integrated database retrieval system