KEGG   Xanthomonas campestris pv. campestris 8004: XC_0344Help
Entry
XC_0344           CDS       T00247                                 

Definition
(GenBank) conserved hypothetical protein
Organism
xcb  Xanthomonas campestris pv. campestris 8004
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trypsin_2 GCV_T_C
Motif
Other DBs
NCBI-ProteinID: AAY47429
UniProt: A0A0H2X2V1
Position
complement(403723..404658)
Genome map
AA seq 311 aa AA seqDB search
MQLASVASRATASLGQVPSRKLWHTLPRRQCWGAWLHHPTFAATHCLTTHSSRSCFATRL
NSSIRPQYRIPVSSLRMGLLYTQQWHSYLWRHQLFDFSPVSNLVFALGRNGPGGVQLLGT
AFALDKPGLFATASHVAGTEGQNLVLAFKPLAALHDYQDTGDTSIRSFPVQIHALDPFHD
LAVLKADVISTSSVVVGGADDATVGTQVASFGFPHADHCRMVLTQQDAEIGARVLIASGG
IKAKHLVLNTQARPGQSGSPIFRKTDGRLVGVLVGSYAPGGGGGISLGGVDPHTLHQTTH
AVSSEYLSKMY
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
ttgcagttggcttcggtggcgtcacgcgccactgcttcgctggggcaagttccatcccgc
aagctgtggcacactctgcccaggcggcagtgctggggagcatggttgcatcatccaacc
tttgcggccactcactgcctaacaactcattcaagccgaagttgcttcgcaactcggctt
aattcaagcattagaccgcagtacagaatccccgtatcgtccctccgcatgggccttctt
tacactcagcagtggcattcatatctttggaggcatcagttgttcgacttcagtcctgtt
tcgaatctcgtctttgcccttgggcgcaacgggccagggggcgttcagcttttgggcact
gcatttgctttagacaagcccggtctcttcgcgacagcgtcgcacgtggcggggacggag
ggacagaaccttgtcctcgccttcaagccgctcgcagcactgcacgactatcaagacacc
ggagacacctccatcaggtcgtttcctgtgcagatccacgcccttgacccgtttcatgac
ctcgccgtccttaaggcagatgtaatctctacgtcgagtgtggtggtaggtggcgcagat
gacgcaacggtgggtacgcaggtcgccagttttggtttcccacacgcggatcactgccga
atggttcttacgcaacaagacgctgagattggggcgcgagttctaatcgcatccggcggc
atcaaggcaaaacacctggtcctaaatactcaggcacgccctgggcagtctggcagtccg
atcttcagaaagactgatggtcggctggtaggggtgctcgtcggctcctatgcccccggg
ggcggcggcggcatatcgttggggggagtcgacccgcacactcttcatcagacgacgcac
gcggtatcgtcggagtacctttctaagatgtactag

DBGET integrated database retrieval system