KEGG   Xanthomonas campestris pv. campestris 8004: XC_0639Help
Entry
XC_0639           CDS       T00247                                 

Definition
(GenBank) cellulase
  KO
K01179  endoglucanase [EC:3.2.1.4]
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Pathway
xcb00500  Starch and sucrose metabolism
xcb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xcb00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    XC_0639
Enzymes [BR:xcb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     XC_0639
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cellulase CBM_2 DEC-1_N Lamp
Motif
Other DBs
NCBI-ProteinID: AAY47719
UniProt: A0A0H2X429
Structure
PDB: 

Position
complement(766737..768191)
Genome map
AA seq 484 aa AA seqDB search
MSIFRTASTLALATALALAAGPAFSYSINNSRQIVDDSGKVVQLKGVNVFGFETGNHVMH
GLWARNWKDMIVQMQGLGFNAVRLPFCPATLRSDTMPASIDYSRNADLQGLTSLQILDKV
IAEFNARGMYVLLDHHTPDCAGISELWYTGSYTEAQWLADLRFVANRYKNVPYVLGLDLK
NEPHGAATWGTGNAATDWNKAAERGSAAVLAVAPKWLIAVEGITDNPVCSTNGGIFWGGN
LQPLACTPLNIPANRLLLAPHVYGPDVFVQSYFNDSNFPNNMPAIWERHFGQFAGTHALL
LGEFGGKYGEGDARDKTWQDALVKYLRSKGINQGFYWSWNPNSGDTGGILRDDWTSVRQD
KMTLLRTLWGTAGNTTPTPTPTPTPTPTPTPTPTPTPTPGTSTFSTKVIVDNSWNGGYCN
RVQVTNTGTASGTWSIAVPVTGTVNNAWNATWSQSGSTLRASGVDFNRTLAAGATAEFGF
CAAS
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgtccatattcaggaccgcaagcacgctcgctttggccaccgccctcgcactggccgcc
gggccggccttcagctattccatcaacaacagcaggcagatcgtcgacgacagcggcaag
gtcgtgcagctcaagggtgtgaacgtgttcggcttcgaaaccggcaaccacgtgatgcat
ggcctgtgggcacgcaactggaaggacatgatcgtgcagatgcagggcctgggcttcaac
gccgtgcgcctgccgttctgcccggccacgctgcgtagcgacaccatgccggccagcatc
gactacagccgcaacgccgacctgcagggcctgacctcgctgcagatcctcgacaaggtg
atcgccgaattcaatgcgcgcggcatgtatgtgctgctggatcaccacacccccgattgc
gccggcatttccgagctctggtacaccggctcctataccgaggcacagtggctggccgac
ctgcgctttgtggccaaccgctacaagaacgtgccgtatgtactcggcctggatctgaag
aacgaaccgcacggcgccgccacctggggtaccggcaacgccgccaccgattggaacaag
gctgccgagcgcggctcggccgcggtgttggcggtcgcgccgaagtggctgatcgcggtg
gaaggcatcaccgacaacccggtgtgctccaccaacggcggcatcttctggggcggcaac
ctgcagccgctggcctgcaccccgctcaacatcccggccaaccgcctgctgctggccccg
cacgtgtacggcccggacgtgttcgtgcagtcgtacttcaacgacagcaacttccccaac
aacatgcccgccatctgggaacgccatttcggtcagttcgccggcacgcatgcgctgttg
ctgggcgagttcggtggcaagtacggcgaaggcgacgcacgcgacaagacctggcaggac
gcgctggtgaagtacctgcgcagcaagggcatcaaccagggcttctactggtcgtggaat
cccaacagcggcgacaccggcggcatcctgcgcgatgactggaccagcgtgcgccaggac
aagatgaccctgctgcgcacgctgtggggcaccgccggcaataccacgccgacgccgact
cccacacctacgcccacaccgacaccgacgcctacccccacgccgacgcccaccccgggc
accagcaccttcagcaccaaggtgatcgtggacaacagctggaacggcggctattgcaac
cgcgtgcaggtgaccaacaccggcaccgccagcggcacctggtcgatcgcggtgccggtc
accggtacggtcaacaacgcctggaatgcgacctggtcgcagagcggcagcacgctcaga
gccagcggcgtggacttcaaccgcaccctggcagccggcgccaccgccgagttcggcttc
tgcgccgcgagctga

DBGET integrated database retrieval system