KEGG   Xanthomonas campestris pv. campestris 8004: XC_0962Help
Entry
XC_0962           CDS       T00247                                 

Definition
(GenBank) Ham1 like protein
  KO
K02428  XTP/dITP diphosphohydrolase [EC:3.6.1.66]
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Pathway
xcb00230  Purine metabolism
Brite
KEGG Orthology (KO) [BR:xcb00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    XC_0962
Enzymes [BR:xcb01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.66  XTP/dITP diphosphatase
     XC_0962
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ham1p_like
Motif
Other DBs
NCBI-ProteinID: AAY48036
UniProt: Q4UY37
Position
1154615..1155238
Genome map
AA seq 207 aa AA seqDB search
MGSTGAQAMKHLVLASGNAGKLEELRAMLADLPLQIVAQGELGVDDVPETGLTFVENALI
KARHASTVTGLPALADDSGLIVDALGGAPGLYSARYAGSPTDANANNAKLLEAMREIPAE
RRSARFYAVIVLLRHPEDPQPLIAEGSWEGVITTAPRGTGGFGYNPVFLDPVHGLTAAEM
DTALKNRLSHRAVALATLQHKLHALSL
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
gtgggatctactggagcccaagcaatgaaacacctggtcctggccagcggcaacgccggc
aagctggaagaactgcgcgccatgctcgccgatctgccattgcagatcgtggcgcagggc
gagctcggcgtggacgatgtgcccgaaaccgggctcaccttcgtcgagaacgccctgatc
aaggcacgccacgccagcacggtgaccggtctgccggcactggccgacgactccgggttg
atcgtcgatgcactcggcggtgcgcccggtttgtacagcgcgcgctacgcgggcagcccg
accgatgccaacgccaacaacgcaaagctgctcgaggccatgcgcgagatcccggccgag
cgccgcagcgcgcgcttctacgcggtgatcgtgctgctgcgccacccggaagatccgcaa
ccgctgatcgccgaaggcagctgggaaggcgtgatcaccaccgcaccgcgcggcaccggc
ggcttcggctacaacccggtgttcctggacccggtgcacggcctgaccgccgccgagatg
gacaccgcgctgaagaaccgcctgagccaccgcgcagtagcgctggccacgctgcagcac
aagctgcacgccctgtcactttga

DBGET integrated database retrieval system