KEGG   Xanthomonas campestris pv. campestris 8004: XC_1062Help
Entry
XC_1062           CDS       T00247                                 

Definition
(GenBank) two-component system sensor protein
  KO
K02668  two-component system, NtrC family, sensor histidine kinase PilS [EC:2.7.13.3]
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Pathway
xcb02020  Two-component system
Brite
KEGG Orthology (KO) [BR:xcb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    XC_1062
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:xcb01001]
    XC_1062
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:xcb02022]
    XC_1062
   02035 Bacterial motility proteins [BR:xcb02035]
    XC_1062
Enzymes [BR:xcb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     XC_1062
Protein kinases [BR:xcb01001]
 Histidine kinases
  NtrC family
   XC_1062
Two-component system [BR:xcb02022]
 NtrC family
  PilS-PilR (type 4 fimbriae synthesis)
   XC_1062
Bacterial motility proteins [BR:xcb02035]
 Pilus system
  Twitching motility proteins
   XC_1062
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HisKA PAS_8 HATPase_c_2 MLTR_LBD PAS PAS_4
Motif
Other DBs
NCBI-ProteinID: AAY48132
UniProt: A0A0H2X574
Position
complement(1278821..1280431)
Genome map
AA seq 536 aa AA seqDB search
MASSVSLIDRIQSAPQRELYFFSLYRVLVAGLIAALVFSPLSDAIPEPRYPRLAAGVAIG
YLSMAIPLLFWGRSERRLTATVLCAVLADILAATLATHALPGASDGIAMMLLFNVAAGSI
LLRLRYGMSVAVVASTAIVLEYLWTLLEGGTTRPVAELAMFATSYVAVAYICQQIASRAR
SNQALAEQRGAQVANLYEINELIIRRMRTGVLVVDTHNRITLANEAALALLGDGDQRNAP
ADLALAALTPELARRLQRWRSGWRQEESPLQLGADRPEVQPRFVRLLADSDLVLIFLDDA
SVVSRRAESLTLSAMGRFSASLAHEIRNPLAAINYASQLLEESPDIGDADRRLLQIIHQQ
CQRTNGIVESVLGLARRERASPENLDLAAFVRRFVVEYRQTLSMETDILEASIEGASVHA
LIDPKHLHQVLTALVHNALKYGRILDEPARVKLRVERRERMVAIDVIDRGPGIPETVAAQ
LFRPFYTTSEHGTGLGLYIAQELCRANQAQLDYVSVPGGGACFRILLQGPNGLFGK
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
gtggcatccagcgtatcgctcatcgaccggatccagtcggcgccgcagcgcgagctgtat
ttcttctcgctgtaccgcgtgctggtggccggcctgatcgccgcgctggtgttcagcccg
ttgtccgacgccatccccgagccgcgctacccgcggttggccgccggggtggcgatcggc
tatctgtcgatggccatcccgctgctgttctggggccgcagcgagcgccgcctcaccgcc
accgtgctgtgcgcggtgctggccgacatcctggccgcgaccctggccacgcacgccctg
cccggcgccagcgacggtatcgcgatgatgctgctgttcaacgtggcggccggctcgatc
ctgctgcggctgcgctacggcatgagtgtcgcggtggtggccagcaccgcgatcgtgctg
gagtacctgtggacgctactggaaggcggcaccacccgcccggtggccgagctggccatg
ttcgccaccagctacgtggcggtggcctacatctgccagcagatcgcctcgcgcgcgcgc
agcaaccaggcgctggccgaacaacgcggcgcgcaggtcgccaacctttacgaaatcaac
gagctgatcatccgccgcatgcgcaccggcgtgctggtggtcgatacccacaaccgcatc
accctggccaacgaagccgccctggcactgctcggcgacggcgaccagcgcaacgccccg
gccgacctggccctggccgcgctcaccccggaactggcgcgccggctgcagcgctggcgc
agcggctggcgccaggaagaatccccgctgcagctgggcgcggaccgccccgaagtgcag
ccgcgcttcgtgcgcctgctcgccgacagcgacctggtgctgatcttcctggacgatgcc
agcgtggtctcgcggcgcgccgaatcgctgaccctctcggccatgggccggttctcggcc
agcctggcccacgagatccgcaacccgctggcggccatcaactacgcctcgcagctgctg
gaagaatcgccggacatcggcgatgccgaccgccgcctgctgcagatcatccaccagcaa
tgccagcgcaccaacggcatcgtcgaaagcgtgctcggcctggcccggcgcgagcgcgcc
agcccggaaaacctggacctggccgcgttcgtgcgccgcttcgtcgtggaataccggcag
accttgtcgatggagaccgacatcctggaagccagcatcgagggcgcctcggtgcacgcc
ttgatcgaccccaagcacctgcaccaggtcctgaccgcgctggtacacaacgcactcaag
tacggccgcatcctggacgagccggcacgggtgaagctgcgggtggagcggcgcgagcgc
atggtggccatcgacgtcatcgaccgtggccccggcattcctgaaaccgtggcagcgcag
ctgttccgaccgttctacaccacctccgaacacggcaccgggctcggcctgtatatcgcc
caggaactgtgccgcgccaaccaggcgcaactggattacgtctccgtccccggcggcggc
gcgtgtttccgcatcctgctacagggcccgaatgggctattcggcaagtag

DBGET integrated database retrieval system