KEGG   Xanthomonas campestris pv. campestris 8004: XC_1577Help
Entry
XC_1577           CDS       T00247                                 

Definition
(GenBank) tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Pathway
xcb00260  Glycine, serine and threonine metabolism
xcb00400  Phenylalanine, tyrosine and tryptophan biosynthesis
xcb01100  Metabolic pathways
xcb01110  Biosynthesis of secondary metabolites
xcb01130  Biosynthesis of antibiotics
xcb01230  Biosynthesis of amino acids
Module
xcb_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:xcb00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    XC_1577
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    XC_1577
Enzymes [BR:xcb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     XC_1577
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA PcrB TMP-TENI DUF561
Motif
Other DBs
NCBI-ProteinID: AAY48643
UniProt: Q4UWD0
Position
1895655..1896473
Genome map
AA seq 272 aa AA seqDB search
MSRAPDRIAACFDALRHSGRKALIPFITAGDPSLEATVPVMHALVRAGANIIELGVPFSD
PMADGPTIQRSSERALGRGAGLAYVIEAVQEFRREDATTPVVLMGYLNPIEIHGTRRFAE
TAVAAGIDGVLLVDLPPEEADETRAIFTEVGLALIALASPTTGEARLDMLCSTAQGYLYY
VSFSGVTGAADRLDTHAASDRLRQLRARAGAPVVAGFGIKDAASAAAMAVDADGVVVGSA
LVAALADASDVRSARKRAEDFLQPLRQALDAG
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgagccgcgcgcccgaccgtatcgctgcgtgcttcgacgcgctgcgtcactccggccgc
aaggcgctgattcccttcatcaccgccggcgacccctcattggaagccaccgtgccggtg
atgcatgccctggtgcgcgctggtgcgaacatcatcgagctcggcgtgccgttctccgac
ccgatggccgacggccccaccatccagcgcagctccgagcgcgcgctgggccgcggtgcc
gggctggcctatgtgatcgaagccgtgcaggaattccggcgcgaggacgccaccaccccg
gtggtactgatgggctacctcaacccgatcgaaatccacggcacgcggcgctttgccgaa
accgcggtggccgccggcatcgatggcgtgctgctggtcgacctgccgcccgaggaggcc
gacgagacccgcgccatcttcaccgaggtcggtctggcgctgatcgccttggcgtcgccc
accaccggcgaggcccggctggacatgctgtgcagcactgcgcagggctatttgtattac
gtcagcttctctggcgtgactggcgcggccgaccggctggacacgcacgcggccagcgac
cgcctgcgccagctgcgcgcccgtgccggcgcacccgtggtggccggcttcggcatcaag
gacgccgccagtgctgccgcgatggcggtggatgcggacggcgtggtcgtcggcagcgcg
ctggtggcggccctggccgatgcgtcggatgtgcgcagcgcgcgtaagcgggccgaagac
ttcctgcagccgctgcggcaggcgctggacgccggctga

DBGET integrated database retrieval system