KEGG   Xanthomonas campestris pv. campestris 8004: XC_1634
Entry
XC_1634           CDS       T00247                                 
Name
(GenBank) VirB10 protein
  KO
K03195  type IV secretion system protein VirB10
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Pathway
xcb03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:xcb00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    XC_1634
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:xcb02044]
    XC_1634
Secretion system [BR:xcb02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   XC_1634
SSDB
Motif
Pfam: TrbI INV_N
Other DBs
NCBI-ProteinID: AAY48700
UniProt: A0A0H2X802
Position
1960414..1961595
AA seq 393 aa
MNSNIPNSPEERSRDNRSDGPATNEHDERNNPYFARQQAAAEPDLDANEPVLRSSDMKRL
NRKALVFLALLAGLLLLAIFWLANRSSEDSAPVKPRTETVVAPALPQSMTAPVEMAPVPL
AQQPSLPPLPPMPTDESEIVASAPQQPRGPTLLERRILAEQSATAGSSDGPGLPGEPSAQ
PRGQEQEQVTLAKPISNPDGLLVRGTYIRCILETRIISDFGGYTSCIVTEPVYSINGHNL
LLPKGSKMLGQYGAGEPTTQRLQVVWDRVTTPTGLDVTLMGPGIDTLGSAGHPGDYNAHW
GNKIASALFISLLSDAFKYAAAEYGPETTTIGVGSGIVTQRPFESNTAESMQQLAQQAME
KSGRRPATLTINQGTVLNVYVAKDVDFSAVLPK
NT seq 1182 nt   +upstreamnt  +downstreamnt
gtgaactcaaacattccaaacagccccgaagaacgctcccgggacaatcgatcggacggg
ccagcgacaaacgagcacgatgagcgtaacaatccatatttcgcacgccagcaggcggct
gctgagccggatctggatgcgaatgagcctgtgctgcgttctagcgatatgaagcggttg
aaccggaaggcgctggtgttcctcgcgttgcttgccgggctactgcttttggctattttc
tggttggcaaatcggagttctgaagactctgcaccggtcaagcctcgcaccgaaacggtt
gtcgcaccggcgctgccacagagcatgaccgcgcctgtcgagatggctccggtgccttta
gctcagcagccgagtttgcctcctttgccgcccatgcctaccgatgaaagcgagatcgta
gcttccgctcctcagcagcctcggggtccgaccttattggagcgacgcattctggccgag
cagtccgctactgctggcagctctgatggtcccggtctgccgggcgaacctagtgctcag
cctaggggccaagaacaggaacaggtgacgttggccaagccgattagcaatcctgatggg
ttgctcgtacgtggcacttatatccgttgtattctggagacgcggatcatttcggatttc
ggtggctatacgtcctgcatcgttaccgagcctgtatactcgatcaatgggcacaacctg
ttgttacccaagggctcaaaaatgttgggtcaatacggcgcgggtgagccaacgacccag
cgtctgcaggttgtttgggaccgggtgaccacgcccactggccttgatgtcactctaatg
ggtccaggtatcgacacgctgggcagcgctggtcatcctggcgactacaacgcccactgg
ggcaacaagatcgcctcggcattgtttattagccttttaagcgatgctttcaaatacgcc
gctgcagaatacggtccagagacgactactattggcgttggctccgggatcgttacgcag
aggccattcgagagcaacactgcagagagcatgcagcagcttgcacagcaggccatggaa
aagtcaggtcgtcgcccggcaacgctgacgatcaatcagggaacagtcctgaacgtttac
gttgcaaaggatgtcgatttctcagcggtgctgcctaagtga

DBGET integrated database retrieval system