KEGG   Xanthomonas campestris pv. campestris 8004: XC_2031
Entry
XC_2031           CDS       T00247                                 

Definition
(GenBank) Type IV secretory pathway, VirB4 components
Organism
xcb  Xanthomonas campestris pv. campestris 8004
SSDB
Motif
Pfam: TraC_F_IV P-loop_TraG FtsK_SpoIIIE AAA_22 TrwB_AAD_bind AAA_10 T2SSE AAA_7 AAA_16 ATPase_2 AIG1 DUF87 AAA_29
Other DBs
NCBI-ProteinID: AAY49092
UniProt: A0A0H2X8Z4
Position
complement(2445406..2448270)
AA seq 954 aa
MRWKLPWPKLAAAANGNDEPSDGWLRHVEALRQAGLPEPGAAVQGHRPATVADEQALYDV
APSFVELLPWVEFLPESKSMLLEDGQSVAAFYELVPLGTEGREPGWLAHARDALENALQD
SFDELDENPWVLQLYAQDEPSFDQYMQTLRDYVRPSARDTAFTEFYLRFFSHHLRAVAKP
GGLFEDTVVTRLRWRGQTRRVRMVVYRRSIGQTSRRGQTPEQMLNIVCDRLCGGLANAGI
EARRMVAADIHDWLLRWFNPNPKLLGPGAEDRERFFALARYPDKAEDGEIELASGRDFSQ
RMFFGQPRSDVAQGAWYFDGMPHRVLVTDRLRMPPGTGHLTGETRKGDAINTLFDQMPED
TLMCLTMVATPQDVLESDLNHLARKAVGETLASEQTLKDVHEARSMIGSAHKLYRGSLAF
YLRGHDEAELDRRGLDLANVMLNAGLQPVREEDEVAPLNSYLRWLPCCYNPGLDRKKWYT
QLMFAQHAANLSPVWGRSQGTGHPGITMFNRGGGPITFDPLNRFDRQMNAHLFLFGPTGS
GKSATLNNLLNQVTAIYRPRLFIVEAGNSFGLFAEFARKLGLTVHRVKLAPGVDVSLAPF
ADARRLIETPSDVQTLDADALDEDRPPDATEADEQRDVLGELEITARLMITGDEDKEEAR
MTRADRSLIRQCILDAAEHCVADGRTVLTRDVRNALRTRGQDPTLPETRRVRLLEMADAM
DMFCQGNDGEMFDRPGTPWPEADITLVDLATYAREGYNAQLSIAYISLISTVNNIAERDQ
YLGRPIVNVTDEGHIITKNPLLAPYVVKITKMWRKLGAWFWLATQNIDDLPRAAEPMLNM
IEWWICLSMPPDEVEKIARFRELSPAQKALMLSARKEAGKFTEGVILSKNMEVLFRAVPP
SLYLALAQTEPEEKAERYQLMQQFGISELDAAFKVAEKIDQARGIESPGLDQPQ
NT seq 2865 nt   +upstreamnt  +downstreamnt
atgcggtggaaactcccttggcccaagctggccgccgcagcaaacggaaacgacgagccg
tctgacggatggctgcgccatgtcgaggccttgcgccaagctggcctgcccgaacccggt
gctgcggtccagggccacaggccggcgaccgtggccgacgagcaggcgctgtacgacgtt
gcgccgtcctttgtggaactgctgccctgggtggagttcctgcccgagtcgaagtcgatg
ctgctggaggacgggcaatcggtggcagccttctatgagctggtgccgttgggcaccgag
ggccgggaacccggctggctcgcgcatgcccgcgacgcgttggagaatgcgctccaggac
agcttcgatgaactggatgagaacccttgggtgctccagctctacgcccaggacgagccc
agcttcgaccagtacatgcagaccctgcgcgactacgtgcggccgagtgcccgcgatacg
gcattcaccgagttctacctacgcttcttcagccatcacctgcgcgcggtggccaagccg
ggcggcctgttcgaggacaccgtggtcacgcggctgcgctggcgcggccagactcggcgt
gtacggatggtggtctatcgccgttccatcggacagacgagccgccgtggtcagaccccg
gagcagatgctcaacatcgtctgcgaccgcctgtgcggaggactggcgaacgctggcatc
gaggcccggcgcatggtcgccgcagacattcacgactggctactgcggtggttcaacccg
aatcccaagttgcttggtcctggtgccgaggaccgcgagcgcttcttcgcgctggcgcgc
taccccgacaaagctgaggacggcgagatcgaactggcgagcgggcgggatttcagccag
cggatgttctttgggcaaccacgttccgacgtcgcgcaaggcgcttggtatttcgacggg
atgccgcaccgcgtgctcgtcactgaccggcttcgcatgccaccgggcacggggcacttg
accggcgaaacccgcaagggcgatgcgatcaacacgctgttcgaccagatgcccgaagac
acgttgatgtgcctgacgatggtcgccacgccgcaggacgtcctcgaatcagacctgaac
cacttggcgagaaaggctgtgggcgagacgcttgcgtccgagcagacgctcaaggatgtg
catgaggcgcgctcgatgatcggcagcgcgcataagctctacagaggcagcttggcgttc
tatctgcgtgggcacgatgaagcagaactggaccggcgcggcctcgatctcgcgaacgtg
atgctcaacgccggcttgcagccggtgcgcgaggaagacgaggtggcgccgctcaacagc
tatctgcgctggctgccgtgttgctacaaccctggcctggatcggaagaagtggtacacg
caactgatgttcgcgcagcatgccgcgaacctatcgccggtgtgggggcgcagccagggc
acagggcatcccggcatcacgatgttcaatcgcggcggcgggccgatcaccttcgatccc
ctcaacaggtttgacaggcagatgaatgcccacctcttcctgttcggaccgacgggttcg
ggcaagtcagccacgctcaacaacctgctgaaccaggtcacggcgatctaccggccgcgc
ctgttcatcgtggaggctggcaacagcttcgggctgttcgccgagttcgcgcgcaagctc
ggactgactgtccaccgcgtgaagctcgcacccggggtggacgtgagcctagctcccttt
gctgacgcacgtcgcctgatcgagacgccgagcgacgtgcagacgctcgatgccgatgcg
ctggacgaggaccggccacccgacgccacagaggcggacgagcagcgcgacgtgctaggc
gaactggaaatcaccgcacgcctcatgatcaccggcgacgaggacaaagaggaggcgcgc
atgacgcgcgcggatcgctcgctgatccgtcagtgcatcctcgatgcggccgagcactgc
gtggccgatgggcgcacggtactcacgcgcgacgtgcgcaacgcgcttcgcacccgcggc
caggacccgacgttgccggaaacgcggcgcgtgcgcctactggaaatggccgacgcaatg
gacatgttctgccagggcaacgatggcgagatgttcgaccggcccggcacgccgtggccc
gaggccgacatcacgctggttgatctcgccacctatgcccgcgaaggctacaacgcgcag
ctctccatcgcctacatcagtctgatcagcaccgtcaacaacatcgccgagcgcgaccaa
tacctcgggcggccgatcgtcaacgtgaccgatgaagggcacatcatcaccaaaaatccg
ctgcttgccccttacgtcgtgaagatcacgaagatgtggcgcaagttgggcgcttggttc
tggttggcgacacagaacatcgacgacttgccgcgtgccgcggagcccatgctcaacatg
atcgaatggtggatctgcctgtcgatgccaccggacgaggtggagaagattgcgcgcttc
cgcgaactctcgcccgcgcagaaggcattgatgttgtcagcccgcaaggaagccggcaag
ttcaccgagggcgtcatcctgtccaagaacatggaagtgctcttccgggccgtgccaccg
agcctttacctcgccctcgcgcaaaccgaacccgaggaaaaagccgagcgctaccagctc
atgcagcagttcggcatcagcgagttggacgccgccttcaaggtggccgagaagattgac
caggcgcgcggcattgagtcgccgggcctggaccagccccaatag

DBGET integrated database retrieval system