KEGG   Xanthomonas campestris pv. campestris 8004: XC_2039Help
Entry
XC_2039           CDS       T00247                                 

Definition
(GenBank) conserved hypothetical protein
Organism
xcb  Xanthomonas campestris pv. campestris 8004
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4400 DUF2933
Motif
Other DBs
NCBI-ProteinID: AAY49100
UniProt: A0A0H2X701
Position
complement(2453229..2453978)
Genome map
AA seq 249 aa AA seqDB search
MRDVASTAQREQNQSQGLIVGTLTLPFRLLAVLIGSLLFSIVVECVGMHLFWKDQGWRHS
QQMLQSELGHLSSHFTRSMVVQEPGRTAHELVDTGYEWVFVRSGLLERMSQTAERAHAPS
NGQTRNFRYYISQVYVLTESYLIAAAFTMLTFIVRLLVLVLTLPLIFTAAFVGLIDGLVR
RDVRRFGAGRESGFIYHRAKASLMPLVVLPWVTYLALPISVHPLLILLPSAALLGWAVSL
TAGSFKKYL
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgagagacgtcgcctcaaccgcgcaacgagagcagaaccagagccaaggcctgatcgtc
ggcacccttacgctaccgtttcggctgctcgcggtgttgatcggctcgctgctgttttcg
atcgtcgtggagtgtgtcggcatgcacctgttctggaaggaccagggatggcgccactcc
cagcagatgttgcagtccgaactggggcacctctccagtcacttcacgcgcagcatggtc
gtgcaggagccggggcgcacggcgcacgagctggtggataccggctacgaatgggtgttc
gtgcgctcaggcttgttggaacggatgagccagaccgccgagcgcgcccacgcgccaagc
aacggacagacgcgcaactttcgctactacattagccaagtctacgtcttgaccgagagc
tatctgatcgctgctgccttcacgatgctgaccttcatcgtgcgtctgctggtcctggtt
ctcacgctgccactgatcttcacggcagcattcgttggtttgatcgacggcctggtgcgg
cgcgacgtgcgtcgattcggtgcgggtcgggaatctggctttatttatcaccgggcaaaa
gcgagcctgatgccgctggtcgtgctgccttgggtgacctacctcgcgctgccgatctca
gtgcacccgttgctgatcctcttgcccagcgcagccttgctgggctgggctgtgagtctg
accgccgggagcttcaaaaagtacctctag

DBGET integrated database retrieval system