KEGG   Xanthomonas campestris pv. campestris 8004: XC_2042
Entry
XC_2042           CDS       T00247                                 

Definition
(GenBank) conserved hypothetical protein
Organism
xcb  Xanthomonas campestris pv. campestris 8004
SSDB
Motif
Pfam: SLT Glucosaminidase SLT_3
Other DBs
NCBI-ProteinID: AAY49103
UniProt: A0A0H2X7A5
Position
complement(2456714..2457295)
AA seq 193 aa
MPVLPHLRAVVLAAGLYACAAQAQEMPPPAYQLAAQSAGIPSPVLYAVALQESGIRRHGR
VVPWPWSLNIAGQSRRYATRADACAGLQQAIRSTPHTRIDAGLGQINLGYHQQRYASACD
LLDPYRNLAIAAEILQEQHTPGENWLVAIGRYHRPAGGEPAARYRRSVSRHLARVQGTRP
TTAVLAARQETSP
NT seq 582 nt   +upstreamnt  +downstreamnt
atgcccgtcttgccgcacctgcgtgcagtggtgctagctgcgggcctgtacgcctgcgcc
gcccaggcccaggagatgccgccgccggcctaccagcttgccgcgcagagcgccggcatt
ccttcgccggtgctctacgccgtggccttgcaggagagcggcatccggcgccacgggcgc
gtcgtcccatggccgtggtccctcaacatcgccggccaatcgcgccgctatgcgacccgc
gccgacgcctgcgccggtttgcagcaagccatccgctccacgccgcacacgcgcatcgac
gctggcctgggccagattaacctcggctaccaccagcagcgctacgccagcgcgtgcgac
ttgctcgacccgtaccgcaatctcgccatcgccgccgagatcctgcaagagcagcacacc
cccggcgaaaactggctggtggcgatcggccgctaccaccgccccgccggtggcgagccc
gcagcccgctatcggcgcagcgtgtcccgccacctcgcgcgcgtgcagggcacgcgccca
accaccgcagtcctcgccgcgcggcaggagacctccccatga

DBGET integrated database retrieval system