KEGG   Xanthomonas campestris pv. campestris 8004: XC_2284Help
Entry
XC_2284           CDS       T00247                                 

Definition
(GenBank) chemotaxis related protein
  KO
K03407  two-component system, chemotaxis family, sensor kinase CheA [EC:2.7.13.3]
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Pathway
xcb02020  Two-component system
xcb02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:xcb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    XC_2284
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    XC_2284
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:xcb01001]
    XC_2284
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:xcb02022]
    XC_2284
   02035 Bacterial motility proteins [BR:xcb02035]
    XC_2284
Enzymes [BR:xcb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     XC_2284
Protein kinases [BR:xcb01001]
 Histidine kinases
  CheA family [OT]
   XC_2284
Two-component system [BR:xcb02022]
 CheA family
  CheA-CheYBV (chemotaxis)
   XC_2284
Bacterial motility proteins [BR:xcb02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    XC_2284
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheW HATPase_c Hpt H-kinase_dim HATPase_c_3 HATPase_c_2
Motif
Other DBs
NCBI-ProteinID: AAY49338
UniProt: A0A0H2X7M2
Position
2750800..2752455
Genome map
AA seq 551 aa AA seqDB search
MSAVPDDIAADFIVEAQEILDRLGEQLVSLEQAPDEADQLNAVFRGFHTLKGGAGFLAIK
PMVELCHAAEETLGMARSGQAVLQAHHFDAAQQSLDYLQAMLDAMGSGDPVPHAPASLIA
QFDAKSGPPAVKSAPKAAALAAVPAGQAPAAAGAKATPKAAAKSGGAEAEQTVRVDTKRL
DAIVNLIGELVLSRNRLKTLRTRLRDEELDRAVSTLDIATARLQTAVMRTRMQPVSKVFS
RFPKVARDVARTLSKEVELELIGAETELDRNLVEALADPLVHLVRNAIDHGIESPALREA
TGKPRSGHVRLSAQQEGDYVSIEIQDDGAGIDPERLREIARNKGLIDAEAAARLSTDECL
HLIFMPGFSTKAEVTDISGRGVGMDVVQSRIRELSGQIQIQSELGRGSRFMIRVPLTLAI
LPTLLVQAGEAVYALPLARVVEVLHAPQSSLGWFDGRAVLDRRSHTLPLIDLRRWLGVPA
EQPPLLTVVLLQAGETRFGLVVDQVRGREEVVIKPLPRALRGLPGYAGATLIGDGRMALI
LDVDGLRSSDH
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atgagtgctgttccagacgatattgctgccgatttcatcgtcgaggcccaggaaatcctg
gatcgcctcggcgaacagctggtgtcgctggaacaggcgccagacgaagccgaccagctc
aacgcggtgttccgcggcttccacacgctcaagggcggcgccggctttctggcgatcaag
cccatggtggagctgtgccacgccgccgaagaaaccctcggcatggcgcgctccggccag
gcggtgctgcaggcgcatcacttcgatgccgcgcagcagtcgctggattatctgcaggcc
atgctcgatgcgatgggctcgggtgacccggtgccgcatgcaccggcgtcgctgatcgcg
cagttcgatgccaagagcggcccgccggcggtgaaatccgcgcccaaggctgctgcgctc
gccgcggtgcccgccggccaggcaccggccgccgccggtgccaaggccacgccgaaggcc
gcagccaagagcggtggcgccgaagccgaacagacggtgcgcgtggataccaagcgcctg
gacgccatcgtcaacctgatcggcgaactggtgctctcgcgcaaccggctcaagaccttg
cgcacccgcttacgcgacgaagaactcgaccgcgcggtgagcacgctcgacatcgccacc
gcccgcttgcagaccgcggtcatgcgcacccgcatgcaaccggtgagcaaggtgttctcg
cgctttcccaaggtggcccgcgatgtggcgcgcacgctatccaaggaagtggaactggag
ctgattggcgcggagaccgagctggatcgcaacctggtcgaagccctggccgacccgctg
gtgcacctggtgcgcaatgcgatcgaccacggcatcgaatcaccggcattgcgcgaagcc
accggcaagccgcgtagtggccacgtgcgcctgtccgcgcagcaggaaggcgactacgtc
agtatcgaaatccaggacgacggtgccggcatcgaccccgagcgcctgcgcgaaatcgcc
cgcaacaagggcctgatcgatgcagaagccgccgcgcgcctgagcaccgacgagtgcctg
catctgatcttcatgcccggcttctcgaccaaggccgaggtgaccgacatctccggccgc
ggcgtcggcatggacgtggtgcaatcgcgtatccgcgagctcagcgggcagatccagatc
cagtccgaactgggccgcggcagccgcttcatgattcgcgtgccgctgaccctggcgatc
ctgcccaccttgctggtgcaggccggcgaagcggtctatgccctgccgctcgcccgcgtg
gttgaggtgctgcatgccccgcagtcctcgctcggctggttcgacggccgcgccgtgctc
gatcgtcgttcgcacaccttgccgctgatcgacctgcgccgctggctgggcgtgcccgcc
gaacaaccgccgctgctgaccgtggtgctgctgcaggccggcgaaacccgcttcggcctg
gtggtggaccaggtccgcggccgcgaggaagtggtgatcaagcccctgccccgcgccctg
cgcggcctgcccggctacgccggcgccaccctgatcggcgatggccgcatggcgctgatc
ctggacgtggatgggctgcgttccagcgatcattga

DBGET integrated database retrieval system