KEGG   Xanthomonas campestris pv. campestris 8004: XC_2323Help
Entry
XC_2323           CDS       T00247                                 

Definition
(GenBank) glutamate methylesterase
  KO
K03412  two-component system, chemotaxis family, protein-glutamate methylesterase/glutaminase [EC:3.1.1.61 3.5.1.44]
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Pathway
xcb02020  Two-component system
xcb02030  Bacterial chemotaxis
Module
xcb_M00506  CheA-CheYBV (chemotaxis) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:xcb00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    XC_2323
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    XC_2323
Enzymes [BR:xcb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     XC_2323
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.44  protein-glutamine glutaminase
     XC_2323
Two-component system [BR:xcb02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   XC_2323
Bacterial motility proteins [BR:xcb02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    XC_2323
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheB_methylest Response_reg
Motif
Other DBs
NCBI-ProteinID: AAY49376
UniProt: Q4UU97
Position
2806301..2807377
Genome map
AA seq 358 aa AA seqDB search
MTLETPVRVLIVDDSAVVRQMLTEILSRDPGIEVVGSAADPLLAREKIKRLNPDVITLDV
EMPRMDGLVFLENLMRLRPTPVVMISSLTERGADTTLQALSLGAVDFISKPKIDVARGLE
GYAEEIVSKVKMAAKAKVSALNRPSAPKITLDMQSAPVPGSALRFRTTDRLIAIGASAGG
TEALRVVLEHMPADAPAVVMTQHLPASFSTAFAERLNRHSAMSVREASDGEAILPGHAYL
PPGGQHLRIIRDGARWRCRIDDGPPVNRHKPAVDVLFRSVAANAGPNAVGAILTGMGDDG
ARGLLEMLQAGAPTLVQDEASSVVWGMPGAAYKLGAAQEVVPLERVAERLIALSAQAR
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgacgctggaaactcctgtacgtgtgttgatcgtcgacgactcggcggttgtgcgtcag
atgctcaccgaaatcctctcgcgcgaccccggcatcgaagtcgtcggctcggccgccgac
ccgttgctggcgcgcgaaaagatcaaacgcctcaatccggacgtgatcacgctggatgtg
gaaatgccgcggatggacgggctggtgttcctggaaaacctcatgcgcctgcgccccacc
ccggtggtcatgatttcctcgctgaccgagcgcggcgccgacaccacgctgcaggcgctg
tcgctgggcgcggtggatttcatctccaagcccaagatagacgttgcgcgtggcctggaa
ggctatgccgaagaaatcgtcagcaaggtcaagatggccgccaaggccaaggtgagcgcg
ctcaatcgtcccagcgcgcccaagatcaccctggacatgcagtccgcgcccgtgccgggc
agcgcgctgcgtttccgcacgactgaccgcctgattgccatcggcgcctccgccggcggc
accgaggcgctgcgcgtggtgctggaacacatgccggccgatgcccctgcggtggtcatg
acccagcatctgccggccagcttcagcaccgcatttgccgagcgcctgaatcgccactcg
gcgatgtcggtgcgcgaggccagcgacggcgaagccattctgccgggccacgcctatctg
ccgccgggcggccagcatctgcgcatcatccgtgacggtgcgcgctggcgctgccgtatc
gacgacggcccgccggtcaatcgccacaagccggcggtggacgtgctgttccgttccgtc
gccgccaacgccggcccgaatgcggtcggcgccatcctcaccggcatgggcgacgacggc
gcacgcggcctgctggaaatgctgcaggccggcgcgcccacgctggtgcaggacgaagcc
agcagcgtggtctggggcatgcccggtgccgcctacaaactgggcgctgcgcaggaagtg
gtgcccttggaacgcgtggccgaacgcctcatcgcgctgtccgcacaggcacgctga

DBGET integrated database retrieval system