KEGG   Xanthomonas campestris pv. campestris 8004: XC_2430Help
Entry
XC_2430           CDS       T00247                                 

Definition
(GenBank) Predicted transcriptional regulator
Organism
xcb  Xanthomonas campestris pv. campestris 8004
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: WYL
Motif
Other DBs
NCBI-ProteinID: AAY49480
UniProt: A0A0H2X8A8
Position
complement(2944305..2945219)
Genome map
AA seq 304 aa AA seqDB search
MDKSSHTEPSPSPEGATRPRAKWGQERRLEFIDYRLRWGGELNRSDLTGFFGISVPQASL
DLAEYSKRAPDNLEYDPSARIYRAASDFVAIFPTSDHARYLEDLLRVAVDSEVPYGSFLG
WHPPVSALPRPWRRLEASIVISVVQAIRHSQQLDVRYQSFSDESPSVRSVTPHALVSDGF
RWHMRAYCHKRQDFRDFLLSRVLDIAGSKADRDRAGEDDAWHRQVRLVLVPHPELAPAHQ
ALIELDYGMREGQCELKCRQSLLFYVLQQLGLGDPEAVRSPGQQHLALKNRAELAPFLPR
SALR
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggacaaaagtagtcacacagaaccttcaccgagccccgaaggcgcgaccaggccccgc
gctaagtggggtcaggaaagacggcttgaattcattgattaccgtctgcggtggggtggg
gagctcaatcggagcgacctgaccggctttttcgggatctcggtgcctcaggcatccttg
gacttggccgaatacagcaagcgtgcgcccgacaatttggaatacgacccaagcgcccgg
atctatcgcgcggcatcagactttgttgcgatcttccccaccagtgaccatgcgcgctat
ctcgaagatcttttgcgcgtggcggtggattctgaggtgccctatggaagcttcctcggc
tggcacccaccggtttcggccctgcctcggccctggcgacgcttggaggcgagcatcgtg
atctcggtggtccaagcaatccggcacagccagcagctcgatgtgcgttatcagtccttt
tccgatgagagcccctcggtccgttcggtcacaccccatgcattggtgagtgacggcttc
cgctggcatatgcgcgcctactgccacaaaagacaggacttccgagattttttgctatcg
cgtgtattggatattgctgggagcaaagccgaccgagatcgagccggcgaagacgacgct
tggcaccgccaggtgcgattggtcttggtgccccatcctgaactcgcgcccgcacaccaa
gctttgattgagcttgactacggcatgcgtgaagggcaatgcgaactcaaatgccggcag
tcactgctgttttatgtgctccaacagctaggtttgggcgacccggaggctgtgcgctcg
cctgggcagcagcaccttgcgctcaagaatcgagcagaacttgcgccttttttgccccga
agtgcgcttcgctag

DBGET integrated database retrieval system