KEGG   Xanthomonas campestris pv. campestris 8004: XC_2432Help
Entry
XC_2432           CDS       T00247                                 

Definition
(GenBank) hypothetical protein
Organism
xcb  Xanthomonas campestris pv. campestris 8004
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2254
Motif
Other DBs
NCBI-ProteinID: AAY49482
UniProt: A0A0H2X828
Position
2946336..2946833
Genome map
AA seq 165 aa AA seqDB search
MSTATATSTQSYSVADVELVMRRVTADLIMIASSTGAVTEKHAQDWAHDIEILAKKGYLK
AVDLTLLSDGIEQRATRFDVNVQSGDLTMSRPGGVLWPKVPNAHLQIVLFYTSTYDQSAR
QAMRDKLNISWSPTDADTTQSQLSSHTNRDYASNSFGMQRKDYTR
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccgccactgccacatctactcaaagctactccgttgccgatgttgaactggtc
atgcgccgcgtgacagctgacttgatcatgattgcaagcagcaccggagcggtaacggaa
aagcatgcccaagactgggcgcacgatatcgagatcctggccaagaaaggctatttgaaa
gcagtggatttgacgcttttgagcgatggtatcgaacaacgcgccacgcgatttgacgtc
aatgtgcaatcgggcgatttgaccatgagtcgcccaggtggcgtgctctggcccaaggtc
cccaatgcccatcttcaaatcgtgcttttttacacgagcacctacgatcaatccgcccgc
caagccatgcgcgacaagctcaacatcagttggagtcccacagatgcggacaccactcaa
agtcagctgagctcccacaccaaccgtgattacgccagcaatagctttggcatgcagcgc
aaggattacacccgatga

DBGET integrated database retrieval system