KEGG   Xanthomonas campestris pv. campestris 8004: XC_2435Help
Entry
XC_2435           CDS       T00247                                 

Definition
(GenBank) conserved hypothetical protein
Organism
xcb  Xanthomonas campestris pv. campestris 8004
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNase_T DUF5051 RNase_H_2
Motif
Other DBs
NCBI-ProteinID: AAY49485
UniProt: A0A0H2X8B1
Position
2948884..2949441
Genome map
AA seq 185 aa AA seqDB search
MNDKQEVFISVDVETAGPIPGIYSLLSIGACVIENPVQTYACELKPTTTQADPAALEVTG
LSLERLAREGLAPEVAMREFRTWVLGVCESKGEPVFVGFNAAFDWSFINYYFHRYLGDNP
FGFSALDIKSLYMGAVQCAWHDTRSSQMAKSLQPHLAGNHDAMQDALYQAELFRCVRALT
PARPV
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacaaacaagaagtcttcatctccgtggatgtggaaaccgcaggcccgatcccc
ggcatctactcgctcctttccataggcgcgtgtgtgattgagaacccagttcaaacctac
gcttgtgagctcaaacccacgacgacgcaggccgatcctgcggcattagaagtgacgggg
ctatcgttggagcggctcgctcgtgaaggcttggcgccggaagtggccatgcgggaattt
cggacctgggtgcttggcgtctgcgaatcgaagggagaaccagtgttcgtcgggttcaac
gccgccttcgactggtcgtttatcaactactacttccatcgctatctgggagacaaccca
ttcggattttccgcactggatatcaagtcgctctacatgggcgcggtccaatgtgcgtgg
cacgacacgcgatcaagtcaaatggccaagtcgctccaaccccatctcgcaggcaaccat
gacgcgatgcaagacgcgctttaccaagctgagcttttccggtgcgtgcgggcgctaacg
ccagcccgtcctgtgtga

DBGET integrated database retrieval system