KEGG   Xanthomonas campestris pv. campestris 8004: XC_2437Help
Entry
XC_2437           CDS       T00247                                 

Definition
(GenBank) hypothetical protein - Escherichia coli plasmid ColIa (fragment) gi
Organism
xcb  Xanthomonas campestris pv. campestris 8004
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF790
Motif
Other DBs
NCBI-ProteinID: AAY49487
UniProt: A0A0H2X833
Position
complement(2950636..2951376)
Genome map
AA seq 246 aa AA seqDB search
MGIVTKPISDQMKALSSYLDNQFLDSDKAVPAKPWFRLSFSHLDELKAKIVAGQAAFGKV
QPQGFVIDVVDDHNPTGGEHVLTRLNQKYSFKGRLLVPGEGTAGPWLAIALVALLPGQPS
PQIYQAYLHPLAKLKSYVLVDSGLERKTLDLLKRMLWKFNNINKPFEIIKPLIDLKQDGQ
GVRPDFILEAKGKRLIVETMGFKDEEYLNQKERMHELMRKLPRVVGLFAHDGSNDRDVKA
FVNQLA
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
ttgggcattgtgacgaagcccatcagcgaccagatgaaagcgttgtcctcttacctcgat
aatcagttcctcgactcggataaagcggttccagcaaagccttggttcaggctatcgttt
agccatctcgatgagttgaaagctaagatcgttgcagggcaagcagcttttgggaaggtg
caaccacaaggctttgtgatagatgtcgtcgatgatcacaaccccaccggcggtgagcat
gtcctgacgaggttaaatcagaagtattcctttaaggggcggttgctcgttccgggagag
gggacggcgggcccatggcttgccatcgcgctagtggcattgctgccaggacagccttcg
ccgcagatctatcaagcctacttgcaccccttggccaaacttaaaagctatgtgctggtt
gactcaggactggaaagaaagacgcttgatctgcttaaacgaatgctttggaagttcaat
aatattaataagcccttcgagatcatcaagccgttgatcgacttaaagcaagatggccag
ggagttcgccctgatttcatcttggaggccaagggcaagcgcttgatcgttgaaacgatg
ggcttcaaggatgaggaatatctgaatcagaaggagcgtatgcacgagctgatgcggaaa
ctgcctcgcgtcgttggcctgtttgctcatgacggaagtaacgaccgcgacgtcaaagct
ttcgtcaaccaacttgcctag

DBGET integrated database retrieval system